A Viking's Rage
heather_cooki
  • Bacaan 767,548
  • Undian 26,613
  • Bahagian 29
  • Masa 2h 6m
  • Bacaan 767,548
  • Undian 26,613
  • Bahagian 29
  • Masa 2h 6m
heather_cooki
Cerita lengkap, Pertama kali diterbitkan Nov 30, 2013
2024actionadventuredanesdenmarkenglandepicfeaturedfictionhistoricalhistorylegendlovenorsepaganromanceswordstexttospeechvikingswattpadwattyawards
[2018 Watty's Shortlist] In a brutal world ruled by cruelty and power, Aiya is nothing more than a slave-her life defined by servitude and pain. But when her ruthless Lord betrays her and Northumbria falls under siege by Norse invaders, Aiya's life is shattered once again. Captured by the fierce warriors from across the sea, she is thrust into a harrowing journey that will test her resilience, force her to face unimaginable cruelty, and confront a destiny she never believed possible.

Ragda, the rightful son of the Jarl Lowzow, and his volatile half-brother Dagr lead their warriors on a raid destined to glorify their names. Confident in the favor of their gods, they're unprepared for the chaos that follows when they encounter the fiery slave girl who challenges everything they thought they knew.

A gripping tale of fate, revenge, and an unlikely spark of love that could either save them... or destroy them.

[A FORMER WATTPAD FEATURED STORY] 


    A Viking's Rage,Part I
    Copyright ©2023
    H.H.Cook
    
    ® All rights reserved. No part of this publication may be     reproduced.
                                    
                                  Some mature content.
Hak Cipta Terpelihara
2024actionadventuredanesdenmarkenglandepicfeaturedfictionhistoricalhistorylegendlovenorsepaganromanceswordstexttospeechvikingswattpadwattyawards
Jadual kandungan

29 bahagian

Daftar untuk menambahkan A Viking's Rage pada pustaka anda dan menerima kemas kini
atau
#27fiction
Garis Panduan Isi
You may also like
Ironstorm | Bjorn Ironside | ONC 2023 oleh BreanneLHeureux
14 bahagian Cerita lengkap Matang
|2024 AMBY'S GRAND FAVORITE | |ONC 2023 SHORTLISTER| |FEATURED Wattpad Military Fiction| |2x FEATURED Wattpad fanfic | "She wears her strength and darkness equally well. The girl is half goddess and half hell." Legends are made, battles are fought, and the storm is yet to come. After the death of her fellow comrade, Lieutenant Amirah Grey would do anything to have redemption. On the way to Afghanistan, all control is lost, and down the rabbit hole she went. Waking up on the shores of Kattegat is; the last thing she expected, especially when she is locked in the wrong timeline and ready to pull the trigger. It's 845 and a great war wages from the south; The Seige of Paris. Vowing to aid Bjorn Ironside and Ragnar Lothbrok in one of the most brutal battles of history comes at a cost. Amirah must win the Northmen's war in order to return home. Blood is spilt, lives are lost, and hope still remains. ONC 2023 SHORTLISTED FEATURED: Wattpad Military Fiction | November 27, 2023 | |Ancient Battles| 2024 AMBY'S GRAND FAVORITE(S) Gorgeous cover made by: @HayleyLHeureux Content Warnings Inside Started on: February 26, 2023 Ended on: April 29, 2023 at 12:58 AM (Mountain time) Total word count: 29203 ONC 2023 Prompt: #60
The Daughter of Thunder oleh arviddraws
5 bahagian Sedang Ditulis
Every second friday of the month a new chapter with new drawings! 📜 This is an ongoing story! This means that things might change as I write-scenes may be refined and the story will grow with time. Feedback is always welcome! I'm excited to share this world with you as I build it. Thor is dead. The gods are silent. And winter belongs to the giants. Heidi, the fourteen-year-old daughter of Thor, sets out to reclaim Mjölnir, the only weapon feared by giants-and the key to avenging her father. Guided by a grumpy dwarf, a mysterious wolf, and her reckless rage, Heidi must brave the deadly Jötunheim and prove herself worthy of her father's legacy before Brúkvar, the ice giant, brings Asgård to its knees. A young adult book with gripping Norse-inspired fantasy of revenge, courage, and the storm within. All illustrations are hand-drawn by me! Feel free to check the ''The Mythology behind my story'' where I explore the origins of my characters, tracing their roots back to the actual myths and sagas that inspired them When the book is finished it will be able to be purchased at: www.studioarvid.com Please notify or message me for a pre-order. All Pre-Orders get a set of free Heidi bookmarks.
Vikings choose your fate Book 1 oleh LucyGray1864
65 bahagian Cerita lengkap Matang
Vikings AU: You are Siggy, daughter of Björn and Þorunn, born in 804 AD after the return from England where Þorunn suffered grave injury. However, as much as Björn loved you at your birth, he abandoned you after Þorunn left Kattegat to never return. She asked of Aslaug to take care of you, and left without a word. Here you are, a mere infant, cared for by a woman who only loves her youngest and neglects the other children just as much as you. This is your path, you choose where to go, and where ever fate or destiny may lead you, great adventure awaits.
BLOOD & WINE--B. IRONSIDE oleh darlinggsnight
6 bahagian Sedang Ditulis
BEEN TRYIN' HARD NOT TO GET INTO TROUBLE BUT, I'VE GOT WAR IN MY 𝑴𝑰𝑵𝑫 Yrsa Variksdottir was always plagued within herself. Whether it started when her mother wanted to discard her when she was barely fresh into the world, or whether it was the dreams that seemed eerily true which disturbed her peace. It wasn't until she ventured to Kategatt with her Father and his men to defend Ragnar Lothbrok's claim to his seat against Jarl Borg. Did she meet the one person other than her Father who didn't think she was mad. It just so happened to be the Earl's son. Start-3/1/25 OC x Bjorn Ironside
CROWNED oleh cherrrykate
17 bahagian Cerita lengkap Matang
[completed] If you stood before the Gods at this very moment, would they name you worthy of their domain? Would they look upon the fear you've caused and admire it? Would they pick upon your power and name it almost divine? That was the very thing Asdis Shadoweye craved the most. A life away from her father's shadow, filled with power and fame. However, her Fate trembles beneath her feet when she crosses paths with the very son of Ragnar people fear the most. ❝Power is dangerous. It corrupts the best and attracts the worst. Power is only given to those who are prepared to lower themselves to pick it up❞ -Ragnar Lothbrok !Includes NSFW, mature themes, strong language, violence and gore!
Hearts of the North oleh digitalbookcompany
32 bahagian Sedang Ditulis Matang
Hearts of the North In a world of unrelenting war and fierce loyalty, the heart can become the most dangerous weapon of all. Lagertha, the fierce shieldmaiden and wife of Ragnar Lodbrok, has fought countless battles by her husband's side. But when Rollo, Ragnar's ambitious brother, begins to see her not only as a warrior but as a woman he desires, the bond between blood and love is tested. As the tension between Rollo and Lagertha grows, so does the risk of shattering everything they have built their families, their alliances, and their future. Torn between her loyalty to Ragnar and the undeniable pull of her heart, Lagertha must navigate a treacherous path of desire, honor, and duty. And as the storm of war looms on the horizon, the three are thrust into a battle that will determine the fate of their people and their love. Set against the brutal backdrop of Viking warfare and the quest for power, Hearts of the North is a tale of forbidden passion, betrayal, and the choices that shape the destinies of warriors and leaders alike. When love is at odds with duty, can the heart ever truly find peace? In this sweeping saga, the price of love may be paid in blood. Zayne Carman Zayne Carman Digital Book Company
"Ragnarssons In" - Archive I oleh lisinfleur
200 bahagian Cerita lengkap Matang
First list of parchments publishing the Ragnarssons' reactions to situations proposed by you guys! Requests are open for more on my ask box at Tumblr! Feel free to submit your request!
VIKINGS IMAGINES [BOOK I] oleh ivarhoegh
84 bahagian Cerita lengkap
Vikings imagines from season 1-4, mostly imagines with the sons of Ragnar. *Under edit* [book 1 of 2] highest rank in Fanfiction #223 ivarhoegh © 2017
"Shield & Spirit" ( A Historical Lesbian Romance Story) oleh Chris9417
12 bahagian Cerita lengkap
When Viking shield-maiden Hildr washes ashore on the coast of Vinland after a brutal storm, she is saved by Awi, a skilled and compassionate warrior of the indigenous people. As Brynhildr recovers, she finds herself drawn to Kaya's world-a land of deep traditions, fierce warriors, and a love she never expected. Torn between her past and the life she begins to build, Brynhildr must make a choice: return to her people across the sea or stay with the woman who has captured her heart. But when whispers of war and the arrival of foreign invaders threaten their home, Brynhildr and Kaya must stand together, fighting not just for their people but for the love that binds them. In a world of swords and spirits, where fate is as wild as the ocean, can their love survive the coming storm?
Winterskin (Book One of Wrath & Winter) oleh CMEstopare
38 bahagian Cerita lengkap
Promise the dead but protect the living. Until a promise to the dead forbids her from doing so. Katell Maeva has spent her entire life as a woodcutter. In the summer months she chops wood and in the winter she knocks out wolves. But when food becomes scarce and her family starts to starve, Kat decides she should put her ax arm to work as a shieldmaiden. Something her mother made her promise to never do. Dying words her town won't let her forget. Barred from becoming a shieldmaiden, when Kat mistakenly kills a beast on the outskirts of town she unravels a conspiracy involving creatures thought to have been hunted to extinction centuries ago. Creatures that once threatened to wipe every trace of humanity from the North. To keep her Gram and sisters alive, she'll have to go against her mother's dying wish and break her promise. Picking up shield and ax just as her brother did. A promise that hangs heavy. Barring fangs as real as her ax. ***Updates every Monday, Wednesday, and Friday*** --Feel free to leave your critiques and suggestions, love em!--
You may also like
Slide 1 of 10
Ironstorm | Bjorn Ironside | ONC 2023 cover
The Daughter of Thunder cover
Vikings choose your fate Book 1 cover
BLOOD & WINE--B. IRONSIDE cover
CROWNED cover
Hearts of the North cover
"Ragnarssons In" - Archive I cover
VIKINGS IMAGINES [BOOK I] cover
"Shield & Spirit" ( A Historical Lesbian Romance Story) cover
Winterskin (Book One of Wrath & Winter) cover

Ironstorm | Bjorn Ironside | ONC 2023

14 bahagian Cerita lengkap Matang

|2024 AMBY'S GRAND FAVORITE | |ONC 2023 SHORTLISTER| |FEATURED Wattpad Military Fiction| |2x FEATURED Wattpad fanfic | "She wears her strength and darkness equally well. The girl is half goddess and half hell." Legends are made, battles are fought, and the storm is yet to come. After the death of her fellow comrade, Lieutenant Amirah Grey would do anything to have redemption. On the way to Afghanistan, all control is lost, and down the rabbit hole she went. Waking up on the shores of Kattegat is; the last thing she expected, especially when she is locked in the wrong timeline and ready to pull the trigger. It's 845 and a great war wages from the south; The Seige of Paris. Vowing to aid Bjorn Ironside and Ragnar Lothbrok in one of the most brutal battles of history comes at a cost. Amirah must win the Northmen's war in order to return home. Blood is spilt, lives are lost, and hope still remains. ONC 2023 SHORTLISTED FEATURED: Wattpad Military Fiction | November 27, 2023 | |Ancient Battles| 2024 AMBY'S GRAND FAVORITE(S) Gorgeous cover made by: @HayleyLHeureux Content Warnings Inside Started on: February 26, 2023 Ended on: April 29, 2023 at 12:58 AM (Mountain time) Total word count: 29203 ONC 2023 Prompt: #60

Maklumat lanjut