Awesome family (Minecraft youtuber ff)
BMN112
  • Reads 19,116
  • Votes 475
  • Parts 25
  • Time 47m
  • Reads 19,116
  • Votes 475
  • Parts 25
  • Time 47m
BMN112
Complete, First published Dec 05, 2013
cubesmpmindcrackminecraftmineecraftyoutubepixelpactteamcraftedyoutube
The title pretty much says it all. 
NOTE:
this is not my best book, but it was my first. Please don't judge, I know it's horrible
Public Domain
cubesmpmindcrackminecraftmineecraftyoutubepixelpactteamcraftedyoutube
Table of contents

25 parts

Sign up to add Awesome family (Minecraft youtuber ff) to your library and receive updates
or
#407teamcrafted
Content Guidelines
You may also like
Sisters & Relationships - A Team Crafted Fanficton by Chanosaur
34 parts Complete
*NOTE* This was my very first book on Wattpad, so sorry if the writing sucks. But enjoy this MC book!
Travel | Tommyinnit x reader by psajkola
21 parts Complete
This is my first book so it's kinda shity. My first language isn't english so sorry if i wrote something wrong. Also, you can give your opinion about it :) No smut or anything like that, because he's a minor and he's not comfortable with that 10k- βœ“ 50k- βœ“ 100k-βœ“ Complete: 10.02.21
It's My Turn. (πƒπ’πŒπ!) by chaos-kills
34 parts Complete
**DISCONTINUED** π™Έπšƒ'πš‚ π™Όπšˆ πšƒπš„πšπ™½. . . π–½π—Œπ—†π—‰ / 𝗑 𝗋𝖾𝖺𝖽𝖾𝗋 𝗢𝗻 π˜„π—΅π—Άπ—°π—΅ 🜸 Μ½β‚Š 𝗂𝗇 𝗐𝗁𝗂𝖼𝗁 π—π—ˆπ—†π—†π—’ π–Όπ—‹π—ˆπ—Œπ—Œπ–Ύπ—Œ π—‰π–Ίπ—π—π—Œ 𝗐𝗂𝗍𝗁 𝖺 𝗀𝗂𝗋𝗅 𝖺𝗇𝖽 π—Œπ–Ύπ–Ύπ—†π—Œ π—π—ˆ π—‚π—‡π—π—ˆπ—…π—π–Ύ 𝗁𝖾𝗋 𝗂𝗇 π—π—‚π—Œ 𝗁𝖾𝗅𝗅 π–Ώπ—Žπ—…π—… 𝗅𝗂𝖿𝖾. ⟨⟨ ━━━━ Β© 𝐜𝐑𝐚𝐨𝐬-𝐀𝐒π₯π₯𝐬 ━━━━ 𝖿𝖾𝗆! 𝗋𝖾𝖺𝖽𝖾𝗋 # 𝖼𝗐; π—Œπ–Ύπ—‡π—Œπ—‚π—π—‚π—π–Ύ π—π—ˆπ—‰π—‚π–Όπ—Œ! !! this book has **many** flashback chapters that may confuse you on the timeline of the book. if you aren't a big fan of that i do not suggest reading my work !! most impressive ranks!! β€’ #28 in dsmp
Promise by Happygirl145
31 parts Complete Mature
This is my first fan fiction and I am so excited. Please don't hate. And this contains strong language. Also this is a mix between Minecraft and the real world. BTW sorry if this book might be bad but my friends said it was good, so..... blame them. XD
When fate finally hits. (Sapnap X Reader) by MeanWhileMilo
23 parts Complete
This is my first book, only a joke really, I'm trying!
My Everything | Cube Smp Fanfiction by fanfictionalsimp
26 parts Complete Mature
The Cube Smp fanfiction [Book 1/3] [Completed] (A/N: if things don't add up in real life just ignore, it, for example where people live, it won't always be accurate so just go along with it). *TRIGGER WARNING*
him after me || dnf βœ“ by lovers-luvr
18 parts Complete Mature
It's hard to watch the love of your life spiral into darkness, it's even harder when you cant help. After Oliver's death, he watches over his boyfriend George as he gets pulled into self-destructive behaviours of grief and pain until one day he sees how one person can change George's life. 'him after me', a bitter-sweet love story. ----------------- There's no nsfw!!! This book will contain suicidal themes, death, drugs, alcohol, panic attacks/anxiety, etc. Please be careful. edit: it's been exactly a year since I started this and I strongly dislike it lol - πŸ“† Started: August 1st, 2021 Completed: August 14th, 2021 - πŸ…Top Rankings #4: gay #4: boyxboy πŸ₯‡#1: george πŸ₯ˆ#2: dreamnotfound πŸ₯ˆ#2: minecraft πŸ₯ˆ#2: mcyt πŸ₯‰#3: gream πŸ₯‡#1: gnf πŸ₯ˆ#2: georgenotfound πŸ₯‰#3: sapnap πŸ₯‡#1: dreamwastaken πŸ₯‡#1: dream
Dreamx(fem)Reader by pandoranotfound
28 parts Complete
This book has been edited. It might have small grammar errors or mistakes. I don't plan on fixing them again Dream team book 2/3 Book 2/3 Complete βœ”
"more than that" || quackity by hoshinochann
68 parts Complete
-COMPLETED FINALLY- Planning on rewriting this in another book just to make it better than this current shit
Internet Friends | Hbomb94 Fanfiction by fanfictionalsimp
23 parts Complete Mature
Just Internet friends. That's all we'll ever be. [Completed]
You may also like
Slide 1 of 10
Sisters & Relationships - A Team Crafted Fanficton cover
Travel | Tommyinnit x reader cover
It's My Turn. (πƒπ’πŒπ!) cover
Promise cover
When fate finally hits. (Sapnap X Reader) cover
My Everything | Cube Smp Fanfiction cover
him after me || dnf βœ“ cover
Dreamx(fem)Reader cover
"more than that" || quackity cover
Internet Friends | Hbomb94 Fanfiction cover

Sisters & Relationships - A Team Crafted Fanficton

34 parts Complete

*NOTE* This was my very first book on Wattpad, so sorry if the writing sucks. But enjoy this MC book!

More details