Story cover for The Gangs Together! by blckangells
The Gangs Together!
blckangells
  • WpView
    Reads 473
  • WpVote
    Votes 28
  • WpPart
    Parts 9
  • WpHistory
    Time 18m
  • WpView
    Reads 473
  • WpVote
    Votes 28
  • WpPart
    Parts 9
  • WpHistory
    Time 18m
blckangells
Ongoing, First published May 02, 2017
Mature
50shadesofgreyantisepticeyecrankgameplayscrankycrewdarkiplierhumorjacksepticeyekinkymarkiplierrandom
Hay everyone Hope you like this story! Its my first one! 😊so I'm super excited. Again hope you enjoy!! There is smut so beware!
All Rights Reserved
50shadesofgreyantisepticeyecrankgameplayscrankycrewdarkiplierhumorjacksepticeyekinkymarkiplierrandom
Table of contents

9 parts

Sign up to add The Gangs Together! to your library and receive updates
or
Content Guidelines
You may also like
Demons Can't Love by xitslittyyx
9 parts Complete
*NO SMUT!!! ONLY FLUFFY FLUFF!!❤️❤️ respect what Mark and Sean deem reasonable* The color red made Anti feel warm, too bad red rarely comes. Unless... Septiplier/antiplier/antiseptiplier fanfic. Also: ||Warning mention that there will be mention of blood and gore in this story, if you are easily triggered by that, don't read!! It's not bad, but I don't want people being like "omg ew gross why would u write that"||
Unbalanced Water by FukikgRetarned
6 parts Ongoing Mature
An alternative KNY story. It will mostly focus around Giyuu Tomioka This is my first public story so please do judge it as i want to know where i can improve
My Mafia Boss ( BWWM) by thatwriter_b
16 parts Complete Mature
This is my first story pls don't judge
"Robin?" Rinney story by Biscuitbri34
25 parts Complete
Hi this is my first story it is a rinney story so if you don't ship it that's fine but please do not send hate and thank you too everyone who reads! I hope you love reading this story as much as I'm going to enjoy writing it! :)🌸❤️
All Hope Is Lost by IceQueen713
18 parts Complete Mature
Book 1: Savior. So please read that first. :TRIGGER WARNING:PLEASE READ: trigger warning I will not give any further warning it ruins the atmosphere this story will have topics for a mature audience such as possible lemon rape death slight Gore cursing and is recommended for 18+ or you may read at your own risk, Disclaimer: I Don't own Markiplier/Darkiplier Jacksepticeye/Antisepticeye and NONE of the Artwork or Photo's are Mine they are off of a Public Domain such as Twitter/Facebook. Thank You ♡
Endless Love♡(Muzan X Tanjiro) by Milktea_Kitten_XD
26 parts Complete
This is my first story, so if there is any mistakes, please remind me😘 ⚠️WARNING⚠️ 1. Muzan X Tanjiro (May have some other CP) 2. Bad grammar 3. Has some cursed scenes (You know what I mean😉) 4. If you wanna copy and paste my works, please tell me first😑 5. Don't know what to write next😢
Forget Something? (eyeless jack x reader) by TrashyGurlxoxo
21 parts Ongoing Mature
Uhhh first story ig. Don't correct my grammar or formatting bc idc. Will update when I feel like it. Yes I'm a freak, ik. No like when I get there it's gonna be FREAK DEAKY like even I'm scared for what's to come. But anyways it's gonna be a REAL fleshed out story bc I have nothing else to do. Pray 4 me. And also literally this wasn't even a y/n story at first I just changed it to be less cringey 😭 but in yn we trust 🤞fuck proof reading. Also it's gonna be edgy. #urfamilyisdead cover made by me bc I'm awesome. Eyeless jack is bae
Danti / septiceplier by theturepast
34 parts Complete Mature
Well I'm doing danti Darkiplierxantispeticeye I have bad grammar spelling etc. and I'm trying to be a good right but idk on if I'll do smut I did smut
Creepypasta Boyfriend Scenarios by MariaSoenksen16
55 parts Complete
This is my first one so don't hate if you have request plz tell me there will be more CP, I promise ya'll. thank you so much peace out and enjoy my story ✌
Awaken Love (The Original Septiplier) by bullet6756
28 parts Complete Mature
This story is not ment to arouse. it is meant to be a fun ship that I have created and the smut scenes are needed for this story to work. An by "Original Septiplier" I don't mean the first I just mean the first of my septiplier stories sense there is a different version of this story on my page too.
You may also like
Slide 1 of 10
Demons Can't Love cover
Unbalanced Water cover
My Mafia Boss ( BWWM) cover
"Robin?" Rinney story cover
All Hope Is Lost cover
Endless Love♡(Muzan X Tanjiro) cover
Forget Something? (eyeless jack x reader) cover
Danti / septiceplier cover
Creepypasta Boyfriend Scenarios cover
Awaken Love (The Original Septiplier) cover

Demons Can't Love

9 parts Complete

*NO SMUT!!! ONLY FLUFFY FLUFF!!❤️❤️ respect what Mark and Sean deem reasonable* The color red made Anti feel warm, too bad red rarely comes. Unless... Septiplier/antiplier/antiseptiplier fanfic. Also: ||Warning mention that there will be mention of blood and gore in this story, if you are easily triggered by that, don't read!! It's not bad, but I don't want people being like "omg ew gross why would u write that"||

More details