Bubbles unexpected arrival
SarahsNeko
  • Reads 399
  • Votes 11
  • Parts 3
  • Time <5 mins
  • Reads 399
  • Votes 11
  • Parts 3
  • Time <5 mins
SarahsNeko
Ongoing, First published May 03, 2017
Mature
ididntknowiwaspregnantmpregnewarrivalnewlifeshockvaluetrailerparkboysunexpectedarrival
Bubbles memories tend to be a bit blank at times due to his problems.But when he feels pain and stuff while helping Ricky and Julian out in the trailer park...all 3 boys will get the shock of their life...including Mr. Lahey and Randy...
Public Domain
ididntknowiwaspregnantmpregnewarrivalnewlifeshockvaluetrailerparkboysunexpectedarrival
Table of contents

3 parts

Sign up to add Bubbles unexpected arrival to your library and receive updates
or
Content Guidelines
You may also like
Wendizzy's Writer Room by Wendizzy
2 parts Ongoing
In this book, you'll get a behind the scenes look at how your favorite characters were born, my creative process, and the dirty details never before revealed. Tex's Camp Q&A: Come sit by the fire and ask me whatever you'd like. We can roast marshmallows, tell scary stories, and hang out in the comments like a big, happy family. Gator's Backstage Pass: A place full of secrets. Learn the-sometimes embarrassing-details on how my wildest scenes came to life, facts about the characters, the process, and myself.
You may also like
Slide 1 of 1
Wendizzy's Writer Room cover

Wendizzy's Writer Room

2 parts Ongoing

In this book, you'll get a behind the scenes look at how your favorite characters were born, my creative process, and the dirty details never before revealed. Tex's Camp Q&A: Come sit by the fire and ask me whatever you'd like. We can roast marshmallows, tell scary stories, and hang out in the comments like a big, happy family. Gator's Backstage Pass: A place full of secrets. Learn the-sometimes embarrassing-details on how my wildest scenes came to life, facts about the characters, the process, and myself.

More details