Story cover for Tristan by SallySlater
Tristan
SallySlater
  • WpView
    Reads 26,427
  • WpVote
    Votes 1,233
  • WpPart
    Parts 4
  • WpHistory
    Time 27m
  • WpView
    Reads 26,427
  • WpVote
    Votes 1,233
  • WpPart
    Parts 4
  • WpHistory
    Time 27m
SallySlater
Ongoing, First published Jun 08, 2017
couplegoalsdemonsfantasyhistorical-historical-fantasylovemagicmedievalmedievalfantasypaladinromancesequelsequelshipping
*Companion to Uriel*

Tristan Lyons is hiding out in Haywood, adjusting to his new life as a former paladin and alleged traitor to the crown. But as he trains with the rebel forces, the kingdom falls into chaos, ripped apart by devastating attacks and backstabbing politicians. With Sam and Braeden overseas in Rhea, now Tristan must decide on his own who his real friends are and who is the enemy.
All Rights Reserved
couplegoalsdemonsfantasyhistorical-historical-fantasylovemagicmedievalmedievalfantasypaladinromancesequelsequelshipping
Table of contents

4 parts

Sign up to add Tristan to your library and receive updates
or
#46medievalfantasy
Content Guidelines
You may also like
amants maudits | (hiatus) by SaniCybele
9 parts Ongoing
When a powerful witch hunts the demons responsible for her parents' murder, she finds herself face-to-face with one of the very creatures she despises. But this demon is unlike any other. Dangerous, mysterious, and irresistibly charming, he offers her something no one else can-answers about her parents' death and the secrets of the dark forces that haunt her. As their paths intertwine, she finds herself drawn to him in ways she never imagined. But trust is fragile, and the more she learns, the more complicated their connection becomes. Her mission for vengeance soon becomes tangled with her feelings for him, and a forbidden bond starts to grow between them-one that threatens everything she thought she knew about love, loyalty, and the demons she's vowed to destroy. In a world of curses and power, they are two souls bound by tragedy and fate. But their love, born from hatred and deceit, may be the very thing that destroys them both. Will she be able to choose between vengeance and a love that might just save her, or will their doomed connection lead to the death of them both? ----- Written for the Open Novella Contest 2025 Prompt 2 - To be in love with a demon was the last thing on your wishlist ----- Cover by @buterflx1 prologue at the end because of the prologue ban
The TwiceBorn by WyldPatienz
200 parts Complete Mature
Disclaimer,Please Read: This is a story that may contain possible triggers for people who are struggling with different issues in their life. There are chapters within The Twiceborn that deal with violence, rape, and strong language. On more graphic chapters, I will post a warning at the beginning of the chapter. Thank you so much for reading.:)--WyldPatienz Alora is known as The Twiceborn, cast adrift from her long-dead clan and feared by townsfolk around the countryside for the dark power she commands. Yet some, through desperation,will pay for her services.In return,they get exactly what they pay for. Alora is tormented by her legacy and is forced to confront it head on when she meets Islinn, her exact opposite in the ongoing struggle between good and evil.In a harsh world of slavery and superstition, Alora comes to realize, through her association with Islinn, that there is no true evil in the world, only good tortured by need.
What Dark Worlds Hold Before Us by Oniwaffle
8 parts Complete
When a young nameless girl wakes up in a peculiar world, she looses feeling and memory of herself. Why she got there, who she used to be, what some of the things she was feeling even were. She was like an empty shell. In this new world she's rescued by this strange hero that appears to be a young man, around the age of her own. He's a very secretive fighter, but is clearly doing all he can to help with his cheery attitude. Once she steps out into the world she comes to find something incredible. Floating islands, magical creatures, mysterious plants. All she knows is there are creatures that appeared to be men after her, only they resembled more of demons. Her new companion, Kaulder, has set out on a mission to restore her memory and save her from these awful men. Giving the lost girl a name and companionship. He shows her the glimmering world around as they head off on a mission to find a seer to bring back what she had lost. He hoped this creature could heal her broken memory. But at what cost? Join our young lost girl on her journey through a foreign land in this fantasy short story.
Return to Jorgaldur Volume II: the druid archer by lls_sll
170 parts Complete
When she dies of a serious illness, she still remembers her friends from a MMORPG that she had played years ago, and an NPC that has remained in her heart ever since. But when she opens his eyes again, she finds himself in the lonely square that had been the beginning of that game. Has she returned to the place she thought it was just a fantasy? Will she survive? Can she find him? She has only one option before her: to step forward and find out what she is doing there. Note: this is the second volume. It is recommended to start with the first one ^^
Hellborn by N7_Witcher
3 parts Ongoing
Set in a dark fantasy where Angels of Heaven and Demons of Hell fighting on Earth to battle for souls in their endless war, twisted by the supernatural forces. Liam Auster, an dark hero that is driven by revenge to hunt down demons that wronged him, but he's been given a important task by his father; to protect his adoptive sister, Elisabeth Auster. An half human and half demon that carries the Mark of the Hellborn and attracts nightmarish monsters and darkness of evil every nightfall. But when they learn news about their father mysteriously vanished, the two goes on a journey to find their father throughout the Empire isles. 💜Inspirations💜 • Berserk • Supernatural • The Witcher • Evil Dead • Dark Souls ⚔️⚔️⚔️⚔️ 📣Content Guidelines📣 • Mature themes • Strong language • Sexual themes • Violence • Blood and gore Please don't read if your not comfortable any of this 💜 • If you enjoy the story of Liam and Elisabeth Austers, add it in your library for updates and notifications to never miss out! • Anything unrelated, bots and scammers promo, spam or toxic feedbacks without professional and reason will be instant deletion and blocked. • I do not do R4R, so please no advertisement and promo on my wall or my story. • "The Knight Order" was originally a temporary project title till it changed to the official title, Hellborn.
Shadowbound by SuwritersJams
15 parts Ongoing Mature
Born with a secret. Made into a weapon. Bound to a destiny that could save the world-or destroy it. Seraphina Alden always knew she was different. Hidden in the human world to protect her from those who feared her witch-werewolf heritage, she was never meant to fall into the hands of the Facility. But when their twisted experiments pushed her beyond what she was born to be, Seraphina became something far more dangerous-a trihybrid. Witch. Werewolf. Vampire. Now she's on the run, hunted by those who would exploit her newfound power. As she escapes into the supernatural realm, Seraphina must navigate a world of magical academies, ancient prophecies, and powerful factions that fear and despise what she represents. But staying hidden isn't easy, especially when the arrogant and impossibly charming Lucian Ashwood, future Supreme Alpha, keeps crossing her path. As tensions rise and shadows close in, Seraphina realizes she isn't just bound by her blood-she's bound by a prophecy that could alter the fate of the supernatural world forever. In a world of fear and power, what's more dangerous than a trihybrid? A trihybrid who refuses to stay in the shadows.
The Modern Countess by AlexiaPraks
87 parts Complete
When life gives you a second chance in a medieval fantasy world, make sure you revolutionize it. Getting hit by a truck wasn't on my post-graduation bucket list. Neither was waking up as Quinn Fairchild, the illegitimate daughter of a cruel lord in a world of magic and monsters. But at least I got some cool magical powers out of the deal, right? Well, sort of. Sure, I can create modern conveniences and heal people, but now I'm being married off to the infamous Earl of Norsewood-a man whose reputation makes hardened warriors tremble. Turns out this supposedly ruthless earl is actually a gorgeous, caring leader desperately trying to save his dying land. Armed with my 21st-century knowledge, a know-it-all magical creation skill, and a determination to build something amazing, I'm turning this medieval fantasy world upside down. One modern convenience at a time. Now if only I could figure out why my hunky husband keeps looking at me like I'm his personal miracle... The Modern Countess Series (formerly Apparently, I'm the Infamous Earl's Legendary Bride) is a fantasy romance series features a vivacious transmigrated heroine determined to revolutionize a medieval-like, war-torn world with her modern knowledge and magical abilities, alongside a hunky warrior-earl husband hell-bent on protecting his land and people while claiming his wife's heart. This series contains: • Slow Burn Romance • Kingdom Building • Magic System • Found Family • Politics & Intrigue • Food & Cooking • Slice of Life Note: A kingdom-building fantasy series follows protagonists as they develop and manage their domain, from humble villages to sprawling empires, while gathering loyal citizens and allies along the way.
The Dark Prince by gabbyh27
31 parts Complete
This is the sequel to The Lost Princess. Do not read this description if you have not read the first book!!! ***** After the vampire attack, Freya is forced to live among the demons for 6 months while her people mourn the ones they lost. All she wants to do is go back home. Rowan does everything in his power to make her open her eyes to who the fae really are, and who the demons have the potential to be. Treachery and lies are revealed, and Freya doesn't know what to believe. Figuring out which kingdom to rule is the least of her problems. The vampires are hunting her every move, and they are definitely going to strike again. Will Freya make it out alive as both of her kingdoms begin to crumble?
Arwick (A Light Of Roria Sequel) by VicariousFictionite
58 parts Complete
-Enter a world where even a spark of faith can ignite the darkness- Addisyn will leave her old life behind as she plunges into the second installment of The Divinity Series. In this sequel to The Light of Roria, Addisyn will take her place in a prophecy to save the magical realm of Arwick-- a land embroiled in a battle between divinity and dark magic, enslaved by the cruel and sinister King Kane. To restore peace to Arwick, she must find the light of Roria. Even so, Arwick is not all that needs saving during these dark times. Her friends' and family's lives are on the line-- from imprisonment, mistrust of one another, and the seductive evils of dark magic. But Addisyn has faith that the light of Roria can still save the world and those she loves.
You may also like
Slide 1 of 9
amants maudits | (hiatus) cover
The TwiceBorn cover
What Dark Worlds Hold Before Us cover
Return to Jorgaldur Volume II: the druid archer cover
Hellborn cover
Shadowbound cover
The Modern Countess cover
The Dark Prince cover
Arwick (A Light Of Roria Sequel) cover

amants maudits | (hiatus)

9 parts Ongoing

When a powerful witch hunts the demons responsible for her parents' murder, she finds herself face-to-face with one of the very creatures she despises. But this demon is unlike any other. Dangerous, mysterious, and irresistibly charming, he offers her something no one else can-answers about her parents' death and the secrets of the dark forces that haunt her. As their paths intertwine, she finds herself drawn to him in ways she never imagined. But trust is fragile, and the more she learns, the more complicated their connection becomes. Her mission for vengeance soon becomes tangled with her feelings for him, and a forbidden bond starts to grow between them-one that threatens everything she thought she knew about love, loyalty, and the demons she's vowed to destroy. In a world of curses and power, they are two souls bound by tragedy and fate. But their love, born from hatred and deceit, may be the very thing that destroys them both. Will she be able to choose between vengeance and a love that might just save her, or will their doomed connection lead to the death of them both? ----- Written for the Open Novella Contest 2025 Prompt 2 - To be in love with a demon was the last thing on your wishlist ----- Cover by @buterflx1 prologue at the end because of the prologue ban

More details