Story cover for Missing Mum by RebeccaOwl
Missing Mum
RebeccaOwl
  • WpView
    Reads 148
  • WpVote
    Votes 5
  • WpPart
    Parts 2
  • WpHistory
    Time 12m
  • WpView
    Reads 148
  • WpVote
    Votes 5
  • WpPart
    Parts 2
  • WpHistory
    Time 12m
RebeccaOwl
Complete, First published Jul 05, 2017
abusecaroliencarolienfaasdevilfaasfairytalefantasyhappyendinghelpmeiphonemessagesmissingmummodernmodernfairytaleonechaptersatanschoolassignmentshortshortstorysuicide
Emma has always had a hard life. Her dad left, her mum committed suicide, after that they tracked her father down only for her to find out he had turned abusive. Her father got rid of all of her mum's possesions and now all she has left is her phone, which still contained her mum's number. At least once a day she sends messages to her mum's phone. Until one day she gets a reply...
Public Domain
abusecaroliencarolienfaasdevilfaasfairytalefantasyhappyendinghelpmeiphonemessagesmissingmummodernmodernfairytaleonechaptersatanschoolassignmentshortshortstorysuicide
Table of contents

2 parts

Sign up to add Missing Mum to your library and receive updates
or
#956helpme
Content Guidelines
You may also like
Save me - LevixReader (modern AU) by __Yeah___
30 parts Complete Mature
A random short story about a depressed/suicidal girl (reader) meeting Levi after getting kicked out by her parents. Helloa it is me! So the part 2 of this story is on hold as I don't know what to write next sorryyy ( part one end at chap 19 :)) I don't own any aot characters --Warning contains mentions of things like suicide, depression, and self-harm. Read at your own discretion. ( I do not promote any of these stay safe <3 )-- best ranking lolz 2 in levixreader!!!!!! Wtf?! 26/06/2021 18 in aotfanfic 6 in depressedreader 24 in newschool 179 in schoolromance
Midnight Butterfly by prexciado
11 parts Complete
"I have this friend that I care for deeply. Her boyfriend is an asshole, they would fight all the time, yet she can't find it in her to leave him for whatever reason. I try to help her but I never seem to say the right things. She killed herself, she just killed herself without leaving a note or anything. And I can't understand why she did that."
The Canvas by That_one__writer
24 parts Complete
Emma has everything, a perfect boyfriend, loving parents, amazing grades and good friends. But there's a twist, Emma has a horrific past that is soon to swell over her again. Will she make it through? {{I do not promote self harm or eating disorders, I've had them but I'm recovered. ***trigger warning***}}
To Love A Demon [Demon x Reader] by NikFics
27 parts Ongoing Mature
Y/N lives by herself, her mother long since passed and her father out of her life, days always passing her by, nothing to do but waste her time, that is until she makes a mistake. "You're mine, not his. Not anyones. You don't even own yourself" "You can't keep me as if im just some god damn toy" --- How will you're story turn out. Will you fall into a demons jaws, melt the cold heart he has, or will you conquer him maybe even run away and never look back with your protector (Please give this story a chance, the story at first is abit notso well written but the more recent chapters im putting my all in, also sorry for spelling im dyslexic XD)
His Obsession by CaraMichaels2013
34 parts Complete Mature
Adelaide meets her mate on the day she turns eighteen. However, she has a secret that no one knows about, not even her best friend. How long will she be able to keep this secret from her mate? And what will happen when he finds out? *** I never heard him make a sound, so his voice makes me jump as I hear him say "I can smell him on you" from right behind me. I turn around and dread fills me as I look into his dark eyes. They're glowing from the light from the fridge. I stumble over my thoughts but manage to squeak out "I thought you were out on a mission for your Alpha?" "I finished, and now I'm back." His eyes boring a hole through my head. "And I can tell that you've been slutting it up" he says with a look that makes me tremble. I start to shake my head, to try and persuade him that I haven't been doing anything wrong, but he forcefully grabs my jaw and stops me from shaking it. "You really shouldn't lie to me Adelaide, now I'm just going to have to teach you a lesson" he spits out at me. *** This isn't you typical story about werewolves, but I love the idea of mates, so follow these young adults on their journey with a supernatural twist.
"A Father's Words" - Lyle Springs Book One by OddlySpookz
7 parts Ongoing
After suffering abuse at the hands of his father, experiencing a huge loss, and being thrown into foster care along with his younger sister, teenage boy Thomas Aguiar has been put through hell, and can't imagine a life without pain. Even after escaping the abuse, in his head, he still can't escape from his father's words. ------ Total Word Count - 12,835 Words Completed - No ------ The Following Trigger Warnings May Apply to Some Or All Chapters- Referenced/Mentioned Child Abuse, Implied Homicide, Mentioned/Referenced Self Harm, References and Descriptions of Eating Disorders
Invisible by andreaellyce
66 parts Complete Mature
When 18-year-old Emma Dawson was raped after her junior year in high school, her entire world fell apart. Especially when her egocentric father didn't believe a word she said. Her step-brother then gave her an ultimatum, one she couldn't turn down. Luckily for her, she didn't have to live through the torture for a long period of time. But now, since her therapist is forcing her to live with her father for the summer, she has no choice. Live with her stepbrother, allow him to do whatever he wants to her, whenever he wants, or be forced to watch her eight year old sister go through the same torment. Forced to keep her mouth shut, forced to be raped without any control, she decides to stay silent, to never speak to her family, anyone. Until she runs into one of her old friends, Aiden Carter, a loyal, athletic overachiever. Then, she starts to remember her old world, the world that was taken away from her. When she faces her past, her secrets fall apart. She has to let go of the fear, listen to her own voice that has been telling her to break open from the beginning. And if she doesn't, she knows she'll risk losing the one person who is most important to her: Herself.
The Truth Behind These Bruises by almost_writing
10 parts Complete
"I tugged gently at the sleeve that covered the secrets that colored my arms underneath. Ever since my mother had passed, my father never stopped drinking. He focused all his anger on me leaving discolored spots to decorate my arms. The scab-like strokes around my wrist were my own doing. Somehow, punishing myself with more pain helps me learn my lesson. Whatever I am supposed to be learning." Lucy has been abused by her father since her mother had passed away. Although she's always kept it hidden beneath her clothing. Her friends soon become suspicious of her actions after she has decided on taking her life. As she stands at the edge of life and death, Natsu comes to her aid.
ᴄʜᴀʀʟᴏᴛᴛᴇ by Ang3holland
25 parts Complete Mature
(on hold)She's gone through a lot. Of course everyone goes through things in life but what really matters is how you learn to cope.. he might just be her way of coping. ⚠️TW⚠️ This book will include the following: Suicide Mature language Drugs Death Suicidal thoughts Abuse Self-harm Sexual assault ~more to be added~ (Started: 04/15/22) (Finished: 00/00/00) (Edited: 00/00/00) (Re-edited: 00/00/00)
You may also like
Slide 1 of 9
Save me - LevixReader (modern AU) cover
Midnight Butterfly cover
The Canvas cover
To Love A Demon [Demon x Reader] cover
His Obsession cover
"A Father's Words" - Lyle Springs Book One cover
Invisible cover
The Truth Behind These Bruises cover
ᴄʜᴀʀʟᴏᴛᴛᴇ cover

Save me - LevixReader (modern AU)

30 parts Complete Mature

A random short story about a depressed/suicidal girl (reader) meeting Levi after getting kicked out by her parents. Helloa it is me! So the part 2 of this story is on hold as I don't know what to write next sorryyy ( part one end at chap 19 :)) I don't own any aot characters --Warning contains mentions of things like suicide, depression, and self-harm. Read at your own discretion. ( I do not promote any of these stay safe <3 )-- best ranking lolz 2 in levixreader!!!!!! Wtf?! 26/06/2021 18 in aotfanfic 6 in depressedreader 24 in newschool 179 in schoolromance

More details