Missing Mum
RebeccaOwl
  • Reads 145
  • Votes 5
  • Parts 2
  • Time 12m
  • Reads 145
  • Votes 5
  • Parts 2
  • Time 12m
RebeccaOwl
Complete, First published Jul 05, 2017
abusecaroliencarolienfaasdevilfaasfairytalefantasyhappyendinghelpmeiphonemessagesmissingmummodernmodernfairytaleonechaptersatanschoolassignmentshortshortstorysuicide
Emma has always had a hard life. Her dad left, her mum committed suicide, after that they tracked her father down only for her to find out he had turned abusive. Her father got rid of all of her mum's possesions and now all she has left is her phone, which still contained her mum's number. At least once a day she sends messages to her mum's phone. Until one day she gets a reply...
Public Domain
abusecaroliencarolienfaasdevilfaasfairytalefantasyhappyendinghelpmeiphonemessagesmissingmummodernmodernfairytaleonechaptersatanschoolassignmentshortshortstorysuicide
Table of contents

2 parts

Sign up to add Missing Mum to your library and receive updates
or
#762modernfairytale
Content Guidelines
You may also like
Chenford OS - Short Stories. by Harpez
75 parts Ongoing
Some Chenford stories.
Alessia Russo Oneshot by woso_wosolover
167 parts Ongoing
Oneshots on Alessia Russo If you have an ideas on what you want the oneshots to be on then comment at the end of each of them .
No Going Back by AgaciaR
12 parts Ongoing
𝘙𝘢𝘯𝘥𝘰𝘮 𝘙𝘦𝘢𝘭𝘪𝘵𝘪𝘦𝘴 Book 3 Unforgivable Series #2 Where should your husband be when you're having a difficult, risky pregnancy? Right by your side! Where was he though? With his childhood best friend and business partner, partying, kissing and making out or worse. All marriages have ups and downs, but once you take a one-way route of cheating, there is No Going Back.
𝐓𝐡𝐞 𝐔𝐧𝐛𝐫𝐞𝐚𝐤𝐚𝐛𝐥𝐞 𝐁𝐨𝐧𝐝 by 00_mafia_00
38 parts Ongoing
A story of four brothers whose life revolves around each other. Fate wasn't kind to them, but they were in it together, always have been and always will be. The eldest brother who is known to be a cold, arrogant and emotionless CEO can destroy the world for his younger brothers. Dare look at his brothers with any ill intention and he won't think twice before destroying the lives of those individuals. He has been a father figure to his brothers since the death of their parents in a car crash. When it comes to them he is a total softy and looks after their every need, but this doesn't mean that he won't discipline them if they are in the wrong. Will these brothers be able to maintain the unbreakable bond they have? When some secrets are revealed of the younger brother, will the trust remain the same between them? What has fate planned for them? Peep into the story of these brothers to know further about their lives...... 🫣
WOSO Oneshot by woso_wosolover
155 parts Ongoing
A WOSO Oneshot book Oneshots of favourite Women's footballers Mainly the Lionesses, Arsenal Women's team,Chelsea Women's team, Man City Women's team and Man Utd Women's team
🔞ហឹរ 2+3នាទី🥵🔥 by AgustRed0693
19 parts Ongoing
🗣️: បើមិនចូលចិត្ត ពាក្យពេចន៍មិនសមរម្យឬចំៗ សូមកុំចូលអាន [BL]🔥🔞🥵 Tae X +++ (S+E+X) [17.10.24]
မောင့်ထိဂရုံး!Horror! by ThuRa9220
22 parts Complete
"သွေး ဆိုတာ သူတို့နဲ့ ထိုက်တန်လို့ ကျသာပါမောင်" "ေသြး ဆိုတာ သူတို႔နဲ႕ ထိုက္တန္လို႔ က်သာပါေမာင္"
The Life of Amelia Potter (WTM) by JenniferCampbell9
40 parts Ongoing
When the final battle of hogwarts is over, too many people were lost. So the Emerald Trio (aka golden trio) and their friends decided to travel to the past to change the course of the future. Hogwarts Legacy Crossover (Does NOT follow movies. New stroyline. Some dates may differ.) *I do NOT own Harry Potter or J.K Rowling's characters*
Indian short stories by Narrativenest
46 parts Ongoing
Collection of different Indian short stories.
Short Novel by Janely_kim
39 parts Complete
រឿងមួយនេះជាប្រភេទ BL s*x ចង់អានក៏អានចុះតែបើប៉ះពាល់អារម្មណ៍កុំបន្ទោសអ្នកសរសេរឲ្យសោះហើយក្នុងនេះក៏មានពាក្យមិនសរម្យច្រើនដែល🤏🔞 Taekook all story 🤯 ____________________________ Writer by me junalifa <3
You may also like
Slide 1 of 10
Chenford OS - Short Stories. cover
Alessia Russo Oneshot cover
No Going Back cover
𝐓𝐡𝐞 𝐔𝐧𝐛𝐫𝐞𝐚𝐤𝐚𝐛𝐥𝐞 𝐁𝐨𝐧𝐝 cover
WOSO Oneshot cover
🔞ហឹរ 2+3នាទី🥵🔥 cover
မောင့်ထိဂရုံး!Horror! cover
The Life of Amelia Potter (WTM) cover
Indian short stories cover
Short Novel cover

Chenford OS - Short Stories.

75 parts Ongoing

Some Chenford stories.

More details