Saving Nina Sayers.
Ebba_Cassandra
  • Reads 218
  • Votes 8
  • Parts 3
  • Time 14m
  • Reads 218
  • Votes 8
  • Parts 3
  • Time 14m
Ebba_Cassandra
Ongoing, First published Jul 23, 2017
anakinskywalkeranidalaballerinaballetblackswandeathenglishfamoushappyjediloveninasayerssadskywalkerstarwarsswanswanlaketragicwattpad
Anakin and Padmé are on a vacation on Naboo when they suddenly get visited by a mysterious girl named Cassandra, and she shows them a movie named Black Swan. They are told to watch the movie and later get an important mission by Cassandra. The main figure named Nina Seyers looks exactly like Padmé and both Anakin and Padmé gets many questions quickly. After they see the film they are sent to Earth by Cassandra to save Nina. Later they meet Nina and they learns she is a ballerina who just got the role as the Swan Queen in the play Swan Lake. Can they save her from her awful destiny? Read and you will know
Public Domain
anakinskywalkeranidalaballerinaballetblackswandeathenglishfamoushappyjediloveninasayerssadskywalkerstarwarsswanswanlaketragicwattpad
Table of contents

3 parts

Sign up to add Saving Nina Sayers. to your library and receive updates
or
#180ballerina
Content Guidelines
You may also like
Natalie's Diary by KeriHalfacre
41 parts Complete
When Jane Madarang's neighbor Natalie kills herself and leaves behind cryptic instructions, it's up to Jane and her classmates to unearth deadly secrets. ***** Natalie Driscoll is dead. She threw herself out a window and left her neighbor Jane to unravel their town's darkest secrets. Following Natalie's instructions leads Jane to three other high school students who all have something to hide. The four of them must carry out Natalie's final errand while solving the mysteries written in her diary. But the secrets they unearth may be far more dangerous than what they ever imagined. Content and/or trigger warning: This story contains scenes of suicide, violence and murder that may be triggering for some readers. [[word count: 100,000-150,000 words]]
You may also like
Slide 1 of 1
Natalie's Diary cover

Natalie's Diary

41 parts Complete

When Jane Madarang's neighbor Natalie kills herself and leaves behind cryptic instructions, it's up to Jane and her classmates to unearth deadly secrets. ***** Natalie Driscoll is dead. She threw herself out a window and left her neighbor Jane to unravel their town's darkest secrets. Following Natalie's instructions leads Jane to three other high school students who all have something to hide. The four of them must carry out Natalie's final errand while solving the mysteries written in her diary. But the secrets they unearth may be far more dangerous than what they ever imagined. Content and/or trigger warning: This story contains scenes of suicide, violence and murder that may be triggering for some readers. [[word count: 100,000-150,000 words]]

More details