The River Runs Red
BryantHightongue
  • Reads 2,129
  • Votes 208
  • Parts 15
  • Time 2h 1m
  • Reads 2,129
  • Votes 208
  • Parts 15
  • Time 2h 1m
BryantHightongue
Ongoing, First published Jul 24, 2017
actionadventuredragonsepicepicfantasyfantasygameofthroneshighfantasyknightsmagicmedievalmedievalfantasymysterypoliticspowersroyalfamilysuspensetrilogywarwattys2017
☆ A Song of Ice and Fire meets The Lord of the Rings ☆

♡ HIGHEST RANKING #653 IN FANTASY 01/09/2017 ♡

A king dies without naming one of his twin sons heir. The kingdom is thrown into chaos as a consequence, with each of the twins playing his own game to win the thrown. Meanwhile, nobles from every corner of the realm must choose a side or follow their own ambitions, and a warlock named Petrus must find a way to avenge his dead mentor, who was murdered by one of the princes.

Meet kings and queens, nobles and commoners, knights and mercenaries, mages and witches, all in one book.

(BOOK ONE OF THE ANNALS OF ANARCHY)

The cover was made by @ashulman19
All Rights Reserved
actionadventuredragonsepicepicfantasyfantasygameofthroneshighfantasyknightsmagicmedievalmedievalfantasymysterypoliticspowersroyalfamilysuspensetrilogywarwattys2017
Table of contents

15 parts

Sign up to add The River Runs Red to your library and receive updates
or
#214medievalfantasy
Content Guidelines
You may also like
CROWN OF GLASS ✔ by rubyruins
123 parts Complete
❛WHAT HAPPENS WHEN YOU MAKE THE TEN MOST POWERFUL GODS ALIVE PLAY A GAME OF MUSICAL CHAIRS WITH ONE SEAT?❜ They fight - to the death. They fight over three crowns and a throne with steel spiked maces. They despair a little more everyday keeping their vows. They wander in hospitals to find a cure for their torn hearts. They haunt castles and secret passages. They betray the ones they love the most. They are dying women and miserable men. They make peace with their enemies, not friends. Girls of rivers with hair like the night dance down the moon stairs. Goddesses of flame hold out hands which crumble and burn. This story sings of three rings. Of forgotten maps. Of a queen who should not be alive after all she has suffered. But most importantly, it sings of three gilded crowns studded with the jewels of the heavens. Crowns of glass. ➳ Shortlisted for the Wattys 2018. ➳ Now a featured Wattpad story. ➳ Winner of over fifteen prestigious awards. ➳ Highest rank: #2 in Fantasy. ❛NO ONE TOLD ME THAT BEING A QUEEN WOULD MEAN PAYING THE PRICE OF POWER WITH STEEL AND BLOOD, DARLING.❜ rubyruins | all rights reserved ©
Fallen ~ The Tale Of Exploration And Love by nightwriter_writes
47 parts Ongoing
"You were stalking me?" "No! It was my care for you." "Sorry, princess. But I'm obsessed with you." "Why can't she understand my love for her?" A girl and a boy. Simple, right? No. A girl, unaware of her true origin. A boy, rampaging on finding his soulmate. Another boy seeks revenge on the first boy. All three tied in the game of soulmate until one broke the ties. But that isn't easy without knowledge of the bond. A girl: Vaishnavi Rathore; A boy: Vivaan Rajput; Another boy: Naitik Khurana And there comes another boy. All attracted to that one girl. But she is protected by her brothers. Safe from, at least, them for time being. Their life is a roller coaster ride with every kind of emotion. Some tales are good not to be told, but one narrated brought sacrifices, sorrow, and unconditional love for each other. Their life turns upside down when they encounter what they shouldn't have. Join this ride to reveal the truth and life of these teenagers or are they? Are you ready to dive into a new world?? The story is fantasy romance. It's set in a parallel universe with some significant changes though the initial features of exact places remain the same.
Faults by thatrandomemo1
52 parts Complete
A group of teenage boys working together to save their Kingdom from the clutches of the wicked get more than what they expected when plans of revenge don't go as planned. The will to avenge takes over as things spiral out of control. Family tension makes everything more difficult and ultimately leads to more problems. Between corrupt power, lost relationships, and tragedies all around them, the King and the most determined members of the Kingdom are in a race against time. Secrets of the Kingdom and its magic come to light and make everything more unclear. With the bonds of trust and love, the group powers through, but will they defeat the evil they face?
A Fifth Daughter [Book 1: The Dragon Rider] by JJHays
30 parts Complete
A MODERN MEDIEVAL FANTASY #3 in Fantasy |Book 1 of the Fifth Daughter Trilogy| When darkness arises and the world of Fantasy is in danger of being destroyed, the Dragon Riders are the first to show up. Fire and fang, sword and shaft, meet the enemy head on and the wars don't end until the enemy is disbanded. It's not a pretty business, but it must be done to secure the lives of every creature within Fantasy. There are two Rider schools - over thousands of Riders and dragons - and Smoke Green is one of them, no matter how much she dislikes the idea and the heights. Her fate has been chosen, even if she doesn't want it. With a vacant father, a mother who has too many secrets, four older sisters, an older brother, and a three minute older, annoying twin brother, Smoke isn't expected to be much more than a hometown girl of Folklore; who will get a boring desk job and never leave home. But then the Sage of the Burrows proclaims her a Dragon Rider and a Fifth Daughter and Smoke's life changes stories - literally. Moving from Folklore to Legend, Smoke is taught that fears can be conquered and villains do have a hunger for power. She also learns she might just have the power this villain is after. She makes friends: Something she didn't know she could do, she finds her dragon: Someone she didn't know even existed, and she learns her past: Something she didn't know was so complicated. But when rebellions begin to break out across the globe; the world of Fantasy is once again put in danger and the Dragon Riders might not be able to save their home this time around. Especially, when the enemy is from one of their own royal families; once thought incinerated, and his accomplice might just be Smoke's long thought dead father. In this first book of the Fifth Daughter Trilogy, J.J. wants you to forget everything you think you know of mythology and open your mind to a new kind of fantasy. Started: 03.25.15 Restarted: 11.29.16 Completed: 03.01.17
The Bane of the Empire by AnnyVirdi
41 parts Complete
The world is ruled by a tyrant King. The Old King was killed and with him the magic that coursed through the world was sealed away. Dawn Rentradie, a human girl, is sent to Eastmaw to collect a tome that triggers a sequence of events that places her in the path of a Fae warrior named Hunter. Follow Dawn, as she uncovers the secrets of a world just out of reach but all around her. Turns out magic wasn't just a children's story. Genre: Young adult, High Fantasy, Adventure, Romance, Fae Folklore
The Zero Hour | #Wattys2016 by xtoverus
55 parts Complete
The world as we know it is controlled by Nobles - powerful wizards that have power over everything. It is the age of ice; a time of ages past, lost in our historical records and unbeknownst to the world today. The commoners who don't wield magic live under their thrall as slaves, doing everything humanly possible to avoid earning their wrath. A single misstep could spell torture or death. One morning, a commoner accidentally takes matters into his own hands by standing up against a prominent Noble's son. The ensuing altercation enrages the boy's father Malevolent Drake, who delivers an ultimatum: A hundred commoners are to die in three days to restore his house's honor, or the elimination of the entire commoner camp. Faced with that reality, the leader of the camp hatches a plot to bring in outside help to combat the Noble army. With time running short, nobody really knows if the plan will even work - given the fact that the Nobles themselves have a few tricks up their sleeves as well. Tricks that could spell doom for everyone involved... * Highest ranked #63 in Adventure (Apr'16) & #708 in Fantasy (May'16). Updates every Tuesday & Friday :)
Death's End by fredandderrick
41 parts Complete Mature
📘 BLURB Is it possible...to create a world where people will live forever? A world where you and I no longer fear death? Zenvix Nighvicto, prince to the fallen nation of conquerors, knows the answer. Beset by the loss of his homeland, he sets out on a quest with his unruly retainer Yurisviel Yaleheart and the hot-headed sorcerer Jerius Lyvia to stop a man from invoking an ancient ritual that will cease death as they know it. But the odds are stacked against them, as they fall perilously behind time. Thousands have perished with unbridled bloodshed, and sinister plans have been set in motion to thwart the trio. If they fail... Then people will live forever, yes. But not in a way they imagine to be. 🔑CONTENT GUIDELINES Mild language and sexual content Most chapters are safe for work / school ✅ DOs Add us or the story so you won't miss any new updates. Comment away. We love replying to them :) 💡 READ THIS Give your inputs to help us better shape the plot and world of Elaria Highest Rankings: #2 in Action, #5 in Fantasy, #5 in Adventure
The Faerie Curses by August_Blue
55 parts Complete
A war is brewing in The Faerie Realm; it's up to a knight, a prince, and an outcast to stop it. When a sinister and mysterious master takes control of a group of cursed faeries known as the sprites, they want revenge against the fae...and they will stop at nothing to obliterate the kingdoms known as the Faerie Courts in a slaughtering attack on Midsummer's night. When Marissa, a Winter Knight with a dark past, joins forces with the arrogant prince Glen and the runaway sprite Diandre, she knows that they are the fae's only chance of defeating The Master. The first step? Become fugitives. These three will have to race against time to recover the Objects of Power: a wand and a scepter that have been lost for centuries. But to prevent a dark war, Marissa, Glen, and Diandre will be tested like they've never imagined. And it might just cost them their lives. [Completed] Highest Ranking: #724 in Fantasy ALL RIGHTS RESERVED
Emberheart: Tales of Ice and Fire by animadix2011
10 parts Ongoing
Emberheart: Tales of Ice and Fire (Ongoing!) Copyright-All rights reserved October 31, 2012 HAPPY ENDING? There are no happy endings Endings are the saddest part So just give me a happy middle And a very happy start. { This is the story about a fantasy kingdom, friendship. and a love story that can never be forgotten A legend and a prophecy foretold from the past to the future fullfilment that will lasts for a lifetime. } A prophecy foretold in the past to the future fulfillment that will last for a lifetime. Get Ready for the romance and the magical love story and adventures of the characters. Lets go!
The Exiled King by Calagtic
81 parts Complete
Book 1 & 2 | Sunday Updates "The world will return to the nothingness that it was birthed from if the truth is not unveiled." Guardian powers have been passed down for centuries, until they disappeared after a devastating war. Now, 50 years later the powers reappear in six unsuspecting youths who have their lives turned upside down in an instant. Faced with their newfound powers and the responsibilities that come with them, they learn that their world may very well be destroyed if they cannot stop the enemy who wishes to destroy it. Punished by the gods and locked away for centuries, a mysterious wizard escapes his confinement and plots to unleash hordes of demons on the mortal world. But it could all just be an elaborate ruse to cover up something more sinister brewing beneath the surface... See the worlds through the eyes of the young guardians as they embark on an epic, world-spanning journey to discover themselves, their powers and, above all, if they will be the ones to save their world or destroy it. But in a world where all is not as it seems, the guardians must tread carefully, or all hope may be lost... forever. "I enjoyed this book. Well worth a read." - nofear4508 Eventual trilogical compilation | Books 1 and 2 completed. Shadow Kingdoms | Complete Shattered Kingdoms | Complete Fallen Kingdoms | In Progress This story is also posted on RoyalRoad.com Amazing cover by Azanthiel
You may also like
Slide 1 of 10
CROWN OF GLASS ✔ cover
Fallen ~ The Tale Of Exploration And Love cover
Faults cover
A Fifth Daughter [Book 1: The Dragon Rider] cover
The Bane of the Empire cover
The Zero Hour | #Wattys2016 cover
Death's End cover
The Faerie Curses cover
Emberheart: Tales of Ice and Fire cover
The Exiled King cover

CROWN OF GLASS ✔

123 parts Complete

❛WHAT HAPPENS WHEN YOU MAKE THE TEN MOST POWERFUL GODS ALIVE PLAY A GAME OF MUSICAL CHAIRS WITH ONE SEAT?❜ They fight - to the death. They fight over three crowns and a throne with steel spiked maces. They despair a little more everyday keeping their vows. They wander in hospitals to find a cure for their torn hearts. They haunt castles and secret passages. They betray the ones they love the most. They are dying women and miserable men. They make peace with their enemies, not friends. Girls of rivers with hair like the night dance down the moon stairs. Goddesses of flame hold out hands which crumble and burn. This story sings of three rings. Of forgotten maps. Of a queen who should not be alive after all she has suffered. But most importantly, it sings of three gilded crowns studded with the jewels of the heavens. Crowns of glass. ➳ Shortlisted for the Wattys 2018. ➳ Now a featured Wattpad story. ➳ Winner of over fifteen prestigious awards. ➳ Highest rank: #2 in Fantasy. ❛NO ONE TOLD ME THAT BEING A QUEEN WOULD MEAN PAYING THE PRICE OF POWER WITH STEEL AND BLOOD, DARLING.❜ rubyruins | all rights reserved ©

More details