Story cover for Swifting Sands (sequel) by MeemaKya
Swifting Sands (sequel)
MeemaKya
  • WpView
    OKUNANLAR 121
  • WpVote
    Oylar 7
  • WpPart
    Bölümler 4
  • WpHistory
    Süre 16m
  • WpView
    OKUNANLAR 121
  • WpVote
    Oylar 7
  • WpPart
    Bölümler 4
  • WpHistory
    Süre 16m
MeemaKya
Devam ediyor, İlk yayınlanma Ağu 20, 2017
americacrackenglandfanfictionfunnyhetaliahetaliafanfictionhumourislandloveplanescaryshipwreckshrekstrandedweaponsweirdwhatwtfzombie
WARNING; this is part two for DRIFTING DEATH. SOME THINGS MIGHT NOT BE UNDERSTANDABLE IF YOU HAVE NOT READ THE FIRST PART. thank you.
Tüm hakları saklıdır
americacrackenglandfanfictionfunnyhetaliahetaliafanfictionhumourislandloveplanescaryshipwreckshrekstrandedweaponsweirdwhatwtfzombie
İçindekiler

4 bölüm

Eklemek için kaydolun Swifting Sands (sequel) kütüphanenize ekleyin ve güncellemeleri alın
veya
#12hetaliafanfiction
İçerik Rehberi
Ayrıca sevebilecekleriniz
ElleTheShellBell tarafından yazılmış Allies (Tails x Reader) Book 2 adlı hikaye
15 bölüm Tamamlanmış Hikaye
They/them perspective! Following the events of the first book several months have passed. You continue to work in the shadows as you get closer and closer to discovering Eggman's plans and getting the revenge you've craved. The road is long but you've made some allies along the way, and who knows? Maybe you'll make a few more... Writing guides I use: (Y/N) - Your name (Y/A) - Your animal It will be assumed that you have a muzzle, fur and a tail. The writing will vary between yours and Tails' perspectives! This is BOOK2! Link to Book 1 is on my PROFILE or HERE!: https://www.wattpad.com/1392601876-nemesis-tails-x-reader-pt1-going-down-swinging
JosefinAndersson7 tarafından yazılmış Francis x Arthur : This is Love right? adlı hikaye
14 bölüm Tamamlanmış Hikaye
This is based on rp I did with someone and I made it into a fan fiction. so it about England getting taken by Francis someone he love because Francis love him.
GhostlyQueen9 tarafından yazılmış Five Deadly Thorns(Hetalia Fan fic) adlı hikaye
28 bölüm Tamamlanmış Hikaye
There once was five girls, Each a sister to a different country. All are brought together by a common annoyance. Warning this fan-fiction contains: inproper english, ducks, Australians!!!, deadly crowbars, and many possible near death experiences. READ AT YOUR OWN RISK!! I do not own any of the hetalia characters and countrys ONLY the story plot and other characters so DO NOT UNDER ANY CIRCOMESTANCES DISOBEY COPY RIGHT THINGYS THAT I HAVE NO IDEA WHAT THEY MEAN!!! This is my first fic that is being posted so ENJOY!!!
smallchungus69 tarafından yazılmış A Reference Filled Light Novel Tilted: Nintendelion. adlı hikaye
29 bölüm Tamamlanmış Hikaye
This story has been made because i got bored. Read it if you want, I dont really care. Tell me its hot garbage, I don't care. You read it didn't you? This is originally intended as an inside joke but I want fame. So give me likes peasants. All references to existing media are intended, but i don't own said media. I added them to be funny This is a tale of Cautionary Fiction Please leave any complaints to 1-800-STEEMER.
trash_master tarafından yazılmış Melancholia {UsUk Fanfiction} adlı hikaye
5 bölüm Tamamlanmış Hikaye Yetişkin
*Warning* This story deals with heavy topics like suicide and depression. You've been warned. (I'll come up with a description later)
Koolaid-- tarafından yazılmış [{Hetalia Crack~}] adlı hikaye
100 bölüm Tamamlanmış Hikaye Yetişkin
Random story of~ Hetalia craked ships~ Weird Hetalia~ Okay just random in general fan fiction~ This is what happens when I'm bored and....Hetalia is drunk. (0-0")
IceQueen713 tarafından yazılmış Savior adlı hikaye
18 bölüm Tamamlanmış Hikaye Yetişkin
: Book 1 : :TRIGGER WARNING:PLEASE READ: trigger warning I will not give any further warning it ruins the atmosphere this story will have topics for a mature audience such as possible lemon rape death slight Gore cursing and is recommended for 18+ or you may read at your own risk. Disclaimer: I Don't own Markiplier/Darkiplier Jacksepticeye/Antisepticeye and NONE of the Artwork or Photo's are Mine they are off of a Public Domain such as Twitter/Facebook. Thank You ♡
SydsSins tarafından yazılmış Sonic Boom! Series! X Female!Reader adlı hikaye
62 bölüm Tamamlanmış Hikaye Yetişkin
*2018 USA* You're tired of the USA for all it's short comings (ex: the 2016 election, humans eating Tide Pods, being a bad country in general, etc) and you develop technology to travel to Bygone Island for the rest of your life. Read more to figure out who you meet and what happens. *I DON'T OWN SONIC OR ANY CHARACTERS, PLACES OR THINGS MENTIONED IN THIS BOOK* *You have no love interest in this book. You simply interact with the characters in this book, no love.* **CURSING IN BOOK, YOU'VE BEEN WARNED** **Reader is female!** Cover by @AsuniTheCat
yippeekyay tarafından yazılmış Fake Feelings: Banana Bus Squad adlı hikaye
70 bölüm Tamamlanmış Hikaye
Banana bus squad fanfic Ships include: Terrorsnuckle Minicat Daithidecalibre Ohmtoonz H2Ovanoss BasicallyIDoScotty Warnings Assault, weapons, fluffy content, mentions of rape, cutting, and plot twists. (Edit: major character death) PLEASE IF YOU GET BAD FEELINGS ABOUT ANY OF THESE THINGS BE CAUTIOUS. Summary: "I'd do anything for you Ohm." "I know Toonzy." "I'll love you till the day my machinery breaks down." "I know Brian." "Fuck you." "Love you too Tyler." "I'll never be able to live if your not by my side." "I love you Vanoss." "DAIVD YOU BROUGHT ME GUMMY BEARS." "Hell, that's true love right there." "I'm sorry I'm an idiot." "Your my idiot Marcel." ----- Everyone has powers. Wether you can see them or not. Inside every normal human is something...extravagant. While it may not be as powerful as those who's powers are seen, Love can conquer all enemies. Things can be hidden from loves true eyes, and tragedy can strike at the worst times.
deadaccount48 tarafından yazılmış Hetalia England One-Shots. adlı hikaye
6 bölüm Tamamlanmış Hikaye
No lemons/smut, just fluff. These are just little random things I come up with while I should be concentrating in class and decide to write down. May be some crack. Possible cross-overs. If you'd like you can request one-shot ideas you have and I will try to come up with plot for them. Also, if you'd like to use any of the plot-lines in this book, please credit me. I don't own any of the art or characters used in this one-shot book, unless said in the beginning note. Probably slow updates. Contains swearing.
Ayrıca sevebilecekleriniz
Slide 1 of 10
Allies (Tails x Reader) Book 2 cover
Francis x Arthur : This is Love right? cover
Five Deadly Thorns(Hetalia Fan fic) cover
A Reference Filled Light Novel Tilted: Nintendelion. cover
Melancholia {UsUk Fanfiction} cover
[{Hetalia Crack~}] cover
Savior cover
Sonic Boom! Series! X Female!Reader cover
Fake Feelings: Banana Bus Squad cover
Hetalia England One-Shots. cover

Allies (Tails x Reader) Book 2

15 bölüm Tamamlanmış Hikaye

They/them perspective! Following the events of the first book several months have passed. You continue to work in the shadows as you get closer and closer to discovering Eggman's plans and getting the revenge you've craved. The road is long but you've made some allies along the way, and who knows? Maybe you'll make a few more... Writing guides I use: (Y/N) - Your name (Y/A) - Your animal It will be assumed that you have a muzzle, fur and a tail. The writing will vary between yours and Tails' perspectives! This is BOOK2! Link to Book 1 is on my PROFILE or HERE!: https://www.wattpad.com/1392601876-nemesis-tails-x-reader-pt1-going-down-swinging

Daha fazla bilgi