Encore (Book Four of Test the Limits Series)
books_are_my_tardis
  • reads 2,257
  • Stemmen 135
  • Delen 13
  • Tijd 56m
  • reads 2,257
  • Stemmen 135
  • Delen 13
  • Tijd 56m
books_are_my_tardis
Compleet, voor het eerst gepubliceerd aug. 27, 2017
amyplierantisepticeyedarkiplierjacksepticeyemarkiplierpewdiepieseptiishu
Third book in the Test The Limits Series, I'd suggest reading the other two first!
Alle rechten voorbehouden
amyplierantisepticeyedarkiplierjacksepticeyemarkiplierpewdiepieseptiishu
Inhoudsopgave

13 delen

Meld je aan om Encore (Book Four of Test the Limits Series) aan je bibliotheek toe te voegen en updates te ontvangen
or
#682antisepticeye
Inhoudsrichtlijnen
Je bent misschien ook geïnteresseerd in
All Hope Is Lost door IceQueen713
18 Delen Compleet Voor volwassenen
Book 1: Savior. So please read that first. :TRIGGER WARNING:PLEASE READ: trigger warning I will not give any further warning it ruins the atmosphere this story will have topics for a mature audience such as possible lemon rape death slight Gore cursing and is recommended for 18+ or you may read at your own risk, Disclaimer: I Don't own Markiplier/Darkiplier Jacksepticeye/Antisepticeye and NONE of the Artwork or Photo's are Mine they are off of a Public Domain such as Twitter/Facebook. Thank You ♡
In His Arms (Antisepticeye x Female Reader) door Austynlevi
16 Delen Compleet
(Anti and 18 year old female reader.) You are a huge fan of Markiplier, and Jacksepticeye, and fly out to LA for a convention. Obviously stoked to be meeting them, and also about hang out in LA for an entire week. Then your life goes crazy. On the plane you meet who you thought was Sean, but turns out to actually be Anti. Then in the twisted events life, you get an unwanted call from your hometown police, cutting your trip off. During this time you move out to LA...and to Anti. Has a tiny bit of fluff. (YN) = Your Name (LN) = Last Name
Septiplier one shots ^_^ door EmilyWright466
109 Delen Compleet
Hey, I write this pairing a lot, and I figured I may as well have a book to write them in, since most of them are like 1 chapter.
Markipler and Jacksepticeye Imagines §COMPLETE§ door BeetleJinx
101 Delen Compleet Voor volwassenen
A bunch of imagine shit for all you ultra fans out there!
Septic Eyes: An Antisepticeye X Child! Reader (Complete) door NightlySpaceX
29 Delen Compleet Voor volwassenen
You were trying to find your way home after school. It was dark now, and you couldn't seem to find the right street. You're parents were supposed to pick you up, but they were nowhere to be found. A teacher asked if you needed a ride after calling your parents and getting no answer, but you were set on walking home. "I'm a big kid," you exclaimed, starting to walk. Little did you know... Someone had their sights on you. (DISCLAIMER! I DON'T OWN ANY FORMS OF MEDIA IN THIS BOOK UNLESS SPECIFIED. I DO NOT OWN THE PICTURE FOR THE COVER, I MERELY EDITED IT TO SHOW THE TITLE.)
Ask or Dare! door liz91200
74 Delen Compleet Voor volwassenen
The title speaks for itself. Enjoy!
Dare And Ask: Anti/Dark/Mark/Jack door BTS-Sunshine
91 Delen Compleet Voor volwassenen
Truth or dare with Antiisepticeye, Darkiplier, Markiplier, and Jacksepticeye... and me, Prideiplier, and Starryplier! Feel free to ask and dare us anything!
Manifest Darkness (Sequel to Darkness Within) door AntiJill
34 Delen Compleet
(Book 2/3) Mark and Jack are left to deal with the consequences of their choices.
New Save File (Sequel to Not So Virtual Reality) door books_are_my_tardis
8 Delen Compleet
Sequel to Not So Virtual Reality (I highly suggest reading that first before this one)
Ask or Dare #2! door liz91200
57 Delen Compleet Voor volwassenen
My 2nd Ask or Dare book! If you haven't read the first one, you'll miss a bit of their backgrounds, but anyways, I hope you enjoy!
Je bent misschien ook geïnteresseerd in
Slide 1 of 10
All Hope Is Lost cover
In His Arms (Antisepticeye x Female Reader) cover
Septiplier one shots ^_^ cover
Markipler and Jacksepticeye Imagines §COMPLETE§ cover
Septic Eyes: An Antisepticeye X Child! Reader (Complete) cover
Ask or Dare! cover
Dare And Ask: Anti/Dark/Mark/Jack cover
Manifest Darkness (Sequel to Darkness Within) cover
New Save File (Sequel to Not So Virtual Reality) cover
Ask or Dare #2! cover

All Hope Is Lost

18 Delen Compleet Voor volwassenen

Book 1: Savior. So please read that first. :TRIGGER WARNING:PLEASE READ: trigger warning I will not give any further warning it ruins the atmosphere this story will have topics for a mature audience such as possible lemon rape death slight Gore cursing and is recommended for 18+ or you may read at your own risk, Disclaimer: I Don't own Markiplier/Darkiplier Jacksepticeye/Antisepticeye and NONE of the Artwork or Photo's are Mine they are off of a Public Domain such as Twitter/Facebook. Thank You ♡

Meer details