Her Thorns: Sequel to Tainted Love
amo4books
  • Reads 43,714
  • Votes 2,643
  • Parts 34
  • Time 4h 37m
  • Reads 43,714
  • Votes 2,643
  • Parts 34
  • Time 4h 37m
amo4books
Ongoing, First published Sep 17, 2017
actionawesomedramafatefeaturefeaturedfictionhistoryhorrorhumanslovemysterynewpopularrisingromancesequelvampirevampireswattpridewattys2018
"Don't trust anyone here, and especially don't trust me. That was your one mistake." - Rose
Five years after revealing her identity as the White Shadow, Rose's past catches up with her in the form of an old friend, who brings chaos to the Vampire Domain. As Rose struggles to find peace with her history, Reynold struggles to see which side of Rose is real - her flowers or her thorns?

Sequel to Tainted Love!


Milestones:

10/2/17 #330 in vampire!
10/2/17 #237 in vampire!!
10/19/17 #157 in vampire!!!
11/4/17 #98 in vampire!!!!
12/18/17 #90 in vampire!!!!!
1/6/17 #84 in vampire!!!!!
All Rights Reserved
actionawesomedramafatefeaturefeaturedfictionhistoryhorrorhumanslovemysterynewpopularrisingromancesequelvampirevampireswattpridewattys2018
Table of contents

34 parts

Sign up to add Her Thorns: Sequel to Tainted Love to your library and receive updates
or
#505feature
Content Guidelines
You may also like
Back Stronger by mariasnchzxo
32 parts Complete Mature
You may have read stories with the same kind of plot but I have some plot twists here and there in mind, so read on to see what is in store. Rose Kingsley faces struggles just like any teenage girl, and the day her mate rejects her, she runs away not wanting to be anywhere near him because it caused her too much pain. She ends up on another werewolf pack's land, luckily the people who found her were nice and took her in making her apart of their pack. Three years later, her new pack is called to for help by her families pack so she has to go back with her new friends to help her family. She goes back stronger than when she left and nothing will tear her down. Realizations occur, Love rises, Forgiveness is key, Connections are made and amongst all the craziness, Family is most important. •Started 2015 •Finished 2016 * #950 in werewolf * - © All Rights Reserved by Maria Sanchez -
Anything For Rachel by Shelby_Painter
56 parts Complete
***Sequel to 'Roses for Rachel'*** Everything has changed, and the stakes are twice as high. Rachel's story continues.....
Running From the Dark | Double Lives Series | Book 1 by MoonRadianceBooks
17 parts Ongoing Mature
"I never wanted to be a supernatural being. Hiding my identity from the world was arduous." Jake Rose is an intelligent, mysterious, and stubborn teenage boy with a stubborn heart when it comes to certain things. When Jacobe, Jake's twin brother, comes into his life out of the blue, something changed. Something that made Jake change forever. Something that has to be kept a secret, but something that got spilled. Something that made him create a monster. Jacobe begins taunting him, slowly ruining his life and befriending his enemies. Meanwhile, Jake has to be torn in between living a double life and having a normal life, living in fear. Jake seeks help from his best friend, Lulu, which turned into a life-saving romance. Lulu Sandra An ambitious, mature, but yet cheerful young teenage girl who is willing to risk helping Jake with his problems--or rather be protected by him, despite her older sister's rants. Will Jake continue to live in fear? Will Jake be able to keep up with his identity crisis and escape the endless terror? Will Lulu stay by his side? This story is full of dark twists and sparks of romance. #wattpadwerewolf #werewolf #supernatural #teenfiction #Romance
Second Fate by writingonparchment
33 parts Ongoing
When she closes her eyes, she still sees him - and she couldn't despise it more. * Nina was a sixteen-year-old party girl when she met and fell for Vine, a friend of her foster sister and a wolf shifter. After a brutal rejection, she tried everything to forget the scarred stranger and save the last of her self-respect - without much effect. Clueless about the reason behind their strange chemistry, she spends the next seven years waiting to learn about fate's design. The shifter Vine has known a fate bond and remembers how its loss has nearly driven him insane. Faced with a second chance, he is determined not to make the same mistakes with Nina; even if he needs to defy fate in order to protect her from the web of guilt and duties he is trapped in. However, a single question changes the path they are on and promises them both a chance to feel alive again - as long as they survive Vine's past, which is coming for them with bared fangs.
Tainted Love by amo4books
59 parts Complete
For hundreds of years, she's been running from me. Feared by all, the White Shadow was born seconds after the first vampire, Dracula, came to be. You think you know the story, but I assure you that it is dead wrong. The White Shadow is foretold to be the sworn enemy of the vampires... the only one that can kill me, their leader. My name is Reynold C. Dracula, and the White Shadow was once the love of my life. ************* Milestones: First Published: July 5, 2017 7/16/17 Brand new book and already ranked #583 in vampire 7/17/17 ranked #534 in vampire 7/18/17 ranked #448 in vampire 7/19/17 ranked #211 in vampire 7/21/17 ranked #198 in vampire 7/22/17 ranked #156 in vampire 7/23/17 ranked #152 in vampire 8/8/17 ranked #50 in vampire 8/14/17 ranked #36 in vampire 8/19/17 ranked #21 in vampire 9/11/17 ranked #19 in vampire 9/12/17 ranked #18 in vampire 6/19/18 ranked #3 in horror Credit to @meghslove as a comment on the cover
ROSES AFTER THORNS by ruhanishah42
15 parts Ongoing Mature
Well roses are accompanied by thorns always but then what if only thorns comes disguised as ROSES and a stupid teenage girl gets so smitten by those fake roses that she adorns them over her body in and as remnant of the wedding night ? FAST FORWARD - 13 years upon realising she is second time pregnant the THORNS tear away their disguise of a rose and starts adorning 17 year old helper in household .. BETRAYAL cuts deep .. Right ?? she too sinks in depression when whole family including her 12 plus daughter witness him balls deep in maid .. ROSE - REAL FRAGRANT ROSE but withered somewhat due to his unrequited love for his bestie after 13 years comes back to give emotional support to the soul deeply scared by thorns . Supports her , becomes a father to an almost teenage girl who witnessed , what no daughters should ever do , becomes a father to an featus who growth is endangered when its own sperm donor decides to brutally rape the body housing the womb where it resides and is its most safe place . Family happily welcomes back the estranged son who for no apparent reason has left India to settle in USA and has not contacted anyone since the day he had left except for his bade abbu ( Elder brother of father ) and an yearly gift which he would send timely on her birthday ,one who never thought why her bestie has left , seemingly drowned in pure marital bliss except for times when the disguised thorn wasn't hovering over her !( whole day she would't miss him ) Let me take you upon the journey of a ROSE and a soul scared by thorns !! It is necessarily a daily diary of their life after the thorn is divourced and ROSE marries the soul in a intimate ceremony !! Real life events except for the details regarding their those moments as i 😉😉😉 hope married ones knows what conspires between a couple and non married ones you need not know the details as of now .. so shoo shoo shoo away 🫣🫣🫣dont try to peak in and read , for you - teenagers about their
Hiraeth [GxG] by CptKatja
32 parts Complete Mature
~Lesbian romance & Mature language~ *Second book in The Haven Series* *Cannot be read as a stand-alone book* Here we are five years later, fighting for not only our lives but the lives of others again. Only now we are up against an invisible enemy. An enemy that leaves nothing but death, destruction, and chaos in its wake. I know we will have to go to great lengths and make great sacrifices to defeat this adversary, but to what lengths will we have to go? How many sacrifices will we have to make?
Blue Moon~ Blackwater Series 3 by DominaAlexandra
38 parts Complete Mature
Not knowing who she was...what she was, caused; lets say, problems for Kaliska. Kaliska life changed dramatically when she discovered she was more than human. More than vampire or werewolf but both. Finally integrated with her hybrid, Kaliska has control. Her adoptive parents are slowly accepting. She has vampire and werewolves both at her side. She's reunited with her birth mother, Zara. And newly mated to Maia. This all happened five months ago. Trying to live normal in supernatural standards, Kaliska wants to forget the threat that intruded on on her and Maia's mating ritual. The woman who seemed to know Kaliska from another time in her life. With a history of blackouts, Kaliska most figure out what happened in her past. Not to mention learning her father, Lucian is alive...Kaliska and the crew must find a way to save him from the hands of the Vampire Monarch! Seems like they have a lot on their plate. But with her mate, Maia at her side and newly found family of vampire and werewolves, Kaliska will make sure they all end up at top and she is given the chance to finally meet her father. Third of Blackwater Series!
THE ARRIVAL by iam_fisaj
47 parts Complete Mature
An all based African story. "When you begin a journey of revenge, start by digging two graves: one for your enemy, and one for yourself." It all started when Rose found her parents both dead. Living without them wasn't so easy! When your favourite person is your worst enemy in disguise!!!🤔. Love came around accompanied by so many complications. When your revenge is staring at you straight in the eyes but you can't have it. After uncovering all mysteries, Rose accepted that her parents got what they deserved! Why? How? That's what you'll have to find out YOURSELF!
Brotherhood by AGMeira
29 parts Complete
In a world where humans, vampires, werewolves and other mythical creatures live in peace, Elisa Blake finds herself forced to reconnect with her family's past to face dangers she couldn't even imagine, as a new threat menace the cherished peace. Will she be ready when the time comes? Will she be able to protect those she loves? Will she be strong enough to fight the evil that is poisoning the World? She doesn't know, the only thing she knows is that she has to try.
You may also like
Slide 1 of 10
Back Stronger cover
Anything For Rachel cover
Running From the Dark | Double Lives Series | Book 1 cover
Second Fate cover
Tainted Love cover
ROSES AFTER THORNS cover
Hiraeth [GxG] cover
Blue Moon~ Blackwater Series 3 cover
THE ARRIVAL cover
Brotherhood cover

Back Stronger

32 parts Complete Mature

You may have read stories with the same kind of plot but I have some plot twists here and there in mind, so read on to see what is in store. Rose Kingsley faces struggles just like any teenage girl, and the day her mate rejects her, she runs away not wanting to be anywhere near him because it caused her too much pain. She ends up on another werewolf pack's land, luckily the people who found her were nice and took her in making her apart of their pack. Three years later, her new pack is called to for help by her families pack so she has to go back with her new friends to help her family. She goes back stronger than when she left and nothing will tear her down. Realizations occur, Love rises, Forgiveness is key, Connections are made and amongst all the craziness, Family is most important. •Started 2015 •Finished 2016 * #950 in werewolf * - © All Rights Reserved by Maria Sanchez -

More details