Her Thorns: Sequel to Tainted Love
amo4books
  • Reads 43,743
  • Votes 2,643
  • Parts 34
  • Time 4h 37m
  • Reads 43,743
  • Votes 2,643
  • Parts 34
  • Time 4h 37m
amo4books
Ongoing, First published Sep 17, 2017
actionawesomedramafatefeaturefeaturedfictionhistoryhorrorhumanslovemysterynewpopularrisingromancesequelvampirevampireswattpridewattys2018
"Don't trust anyone here, and especially don't trust me. That was your one mistake." - Rose
Five years after revealing her identity as the White Shadow, Rose's past catches up with her in the form of an old friend, who brings chaos to the Vampire Domain. As Rose struggles to find peace with her history, Reynold struggles to see which side of Rose is real - her flowers or her thorns?

Sequel to Tainted Love!


Milestones:

10/2/17 #330 in vampire!
10/2/17 #237 in vampire!!
10/19/17 #157 in vampire!!!
11/4/17 #98 in vampire!!!!
12/18/17 #90 in vampire!!!!!
1/6/17 #84 in vampire!!!!!
All Rights Reserved
actionawesomedramafatefeaturefeaturedfictionhistoryhorrorhumanslovemysterynewpopularrisingromancesequelvampirevampireswattpridewattys2018
Table of contents

34 parts

Sign up to add Her Thorns: Sequel to Tainted Love to your library and receive updates
or
#441rising
Content Guidelines
You may also like
The Hybrid Queen [1] by _Black_Rose_0121
46 parts Complete
She, a newbie vampire with a past that even she doesn't know. He, a 115-year-old vampire-teacher with an interest in her. What could go wrong? She thought her life was normal but it was just a mere lie... Dark secrets waiting to be said... Highest ranked: # 21 In Vampire 7/10/2017 #28 In Vampire 28/09/2017 #31 In Vampire 27/09/2017 # 5 in Adventure 15/11/2018 #2 in Aventure 22/12/2018 #1 in Pureblood 27/12/2018 Complete Finish on 19/09/2017 ~Sequel: The hybrid Guardian~
Back Stronger by mariasnchzxo
32 parts Complete Mature
You may have read stories with the same kind of plot but I have some plot twists here and there in mind, so read on to see what is in store. Rose Kingsley faces struggles just like any teenage girl, and the day her mate rejects her, she runs away not wanting to be anywhere near him because it caused her too much pain. She ends up on another werewolf pack's land, luckily the people who found her were nice and took her in making her apart of their pack. Three years later, her new pack is called to for help by her families pack so she has to go back with her new friends to help her family. She goes back stronger than when she left and nothing will tear her down. Realizations occur, Love rises, Forgiveness is key, Connections are made and amongst all the craziness, Family is most important. •Started 2015 •Finished 2016 * #950 in werewolf * - © All Rights Reserved by Maria Sanchez -
Brotherhood by AGMeira
29 parts Complete
In a world where humans, vampires, werewolves and other mythical creatures live in peace, Elisa Blake finds herself forced to reconnect with her family's past to face dangers she couldn't even imagine, as a new threat menace the cherished peace. Will she be ready when the time comes? Will she be able to protect those she loves? Will she be strong enough to fight the evil that is poisoning the World? She doesn't know, the only thing she knows is that she has to try.
The Vampire's Pet (Published) Book 1 and 2 by molly_grace_s
61 parts Complete
In a world where vampires reigned, Rose had seen and experienced many horrors throughout her life. The very second she was taken, she was forced to become a pet with the sole purpose of cleaning or providing blood for vampires. ​ Her world flipped upside down when Lord Henry bought her. She had never thought that in a sea of ferocious monsters, a lesser evil existed - one who tried to save her from her demons while slaying his own. But is a love forbidden and scorned by many worth fighting for? THIS BOOK HAS 62 CHAPTERS TOTAL BUT IVE HAD TO REMOVE A LOT OF THEM BECAUSE ITS PUBLISHED ON AMAZON. SO THERE R ONLY 20 CHAPTERS ON HERE FOR VP. THERE R MORE CHAPTERS ON INKITT (slowly adding to 52) OR YOU CAN BUY THE BOOK FROM AMAZON (link in bio). THE SEQUEL OF VP IS ON HERE TO: THE VAMPIRE'S SECRET - it's after all the announcements after chapter 20 of VP. Highest rank: #1 in vampire. © copyright Molly Stegall 2017
THE ARRIVAL by iam_fisaj
47 parts Complete Mature
An all based African story. "When you begin a journey of revenge, start by digging two graves: one for your enemy, and one for yourself." It all started when Rose found her parents both dead. Living without them wasn't so easy! When your favourite person is your worst enemy in disguise!!!🤔. Love came around accompanied by so many complications. When your revenge is staring at you straight in the eyes but you can't have it. After uncovering all mysteries, Rose accepted that her parents got what they deserved! Why? How? That's what you'll have to find out YOURSELF!
Running from the Dark | Double Lives Series | Book 1 by MoonRadianceBooks
15 parts Ongoing Mature
"I never wanted to be a supernatural being. Hiding my identity from the world was arduous." Jake Rose is an intelligent, mysterious, and stubborn teenage boy with a stubborn heart when it comes to certain things. When Jacobe, Jake's twin brother, comes into his life out of the blue, something changed. Something that made Jake change forever. Something that has to be kept a secret, but something that got spilled. Something that made him create a monster. Jacobe begins taunting him, slowly ruining his life and befriending his enemies. Meanwhile, Jake has to be torn in between living a double life and having a normal life, living in fear. Jake seeks help from his best friend, Lulu, which turned into a life-saving romance. Lulu Sandra An ambitious, mature, but yet cheerful young teenage girl who is willing to risk helping Jake with his problems--or rather be protected by him, despite her older sister's rants. Will Jake continue to live in fear? Will Jake be able to keep up with his identity crisis and escape the endless terror? Will Lulu stay by his side? This story is full of dark twists and sparks of romance. #wattpadwerewolf #werewolf #supernatural #teenfiction #Romance
Thicker Than Water by brennaiswriting
23 parts Complete Mature
Bridget Sheehan has three major problems. 1. She is a vampire, and has no idea how it happened. 2. Someone is trying to kill her (most likely witches) 3. The handsome vampire who offered her sanctuary wants to... date her? After waking up in the middle of nowhere with partial amnesia, Bridget is whisked away to a mansion full of other vampires. But being the new girl is the least of her problems. Someone is trying to kill her and she has no idea why, the others in the mansion stare at her like they've seen a ghost, and the incredibly handsome and sweet vampire who has offered to protect her is far more virtuous than she had expected. Bridget must learn to hone her new abilities and trust those around her if she plans to defeat those who wish her harm. Because if she can't, her life (and the lives of every supernatural being on earth) will be at stake. --------------------- This story is complete, but I'm working on the first major edit chapter by chapter. *previously titled "Who Wants to Live Forever?" --------------------- 🥈2nd Place Winner of Ace Awards Supreme - Vampire/Werewolf 🥉3rd Place Winner of The Creative Awards - Vampire/Werewolf
ROSES AFTER THORNS by ruhanishah42
15 parts Ongoing Mature
Well roses are accompanied by thorns always but then what if only thorns comes disguised as ROSES and a stupid teenage girl gets so smitten by those fake roses that she adorns them over her body in and as remnant of the wedding night ? FAST FORWARD - 13 years upon realising she is second time pregnant the THORNS tear away their disguise of a rose and starts adorning 17 year old helper in household .. BETRAYAL cuts deep .. Right ?? she too sinks in depression when whole family including her 12 plus daughter witness him balls deep in maid .. ROSE - REAL FRAGRANT ROSE but withered somewhat due to his unrequited love for his bestie after 13 years comes back to give emotional support to the soul deeply scared by thorns . Supports her , becomes a father to an almost teenage girl who witnessed , what no daughters should ever do , becomes a father to an featus who growth is endangered when its own sperm donor decides to brutally rape the body housing the womb where it resides and is its most safe place . Family happily welcomes back the estranged son who for no apparent reason has left India to settle in USA and has not contacted anyone since the day he had left except for his bade abbu ( Elder brother of father ) and an yearly gift which he would send timely on her birthday ,one who never thought why her bestie has left , seemingly drowned in pure marital bliss except for times when the disguised thorn wasn't hovering over her !( whole day she would't miss him ) Let me take you upon the journey of a ROSE and a soul scared by thorns !! It is necessarily a daily diary of their life after the thorn is divourced and ROSE marries the soul in a intimate ceremony !! Real life events except for the details regarding their those moments as i 😉😉😉 hope married ones knows what conspires between a couple and non married ones you need not know the details as of now .. so shoo shoo shoo away 🫣🫣🫣dont try to peak in and read , for you - teenagers about their
Anything For Rachel by Shelby_Painter
56 parts Complete
***Sequel to 'Roses for Rachel'*** Everything has changed, and the stakes are twice as high. Rachel's story continues.....
Dark Desire by Riha_Subha1624
46 parts Ongoing Mature
They say 'Opposites Attract,' but what happens when those opposites carry shadows from their past that threaten to tear them apart? Eran, the carefree, golden-hearted soul who is the kind of guy who believed love could fix anything. He wasn't just a happy-go-lucky soul; he was a dreamer, a romantic at heart. The best friend to everyone suffers heavily for the demise of his close peer still feels that love was magic-something worth chasing no matter the risk. Then there's Rose-enigmatic, guarded, and as alluring as the words she weaves in her secret world of online storytelling. Known by many but understood by none, she shields herself from the world, a sin she committed years ago which continues to haunt her. Her dark, mysterious past lies in stark contrast to the woman she portrays today-one who barely lets anyone in. But what happens when their worlds collide? When Eran's carefree charm meets Rose's enigmatic walls? Will she dare to fall in love, something which she dreads? In a twisted dance of fate, their paths will cross, igniting something neither of them expected. A battle of hearts, where one is locked in the past, and the other hides in the shadows. Love may not be part of the plan-but sometimes, fate doesn't give you a choice. Will they tear each other apart, or can opposites really attract?
You may also like
Slide 1 of 10
The Hybrid Queen [1] cover
Back Stronger cover
Brotherhood cover
The Vampire's Pet (Published) Book 1 and 2 cover
THE ARRIVAL cover
Running from the Dark | Double Lives Series | Book 1 cover
Thicker Than Water cover
ROSES AFTER THORNS cover
Anything For Rachel cover
Dark Desire cover

The Hybrid Queen [1]

46 parts Complete

She, a newbie vampire with a past that even she doesn't know. He, a 115-year-old vampire-teacher with an interest in her. What could go wrong? She thought her life was normal but it was just a mere lie... Dark secrets waiting to be said... Highest ranked: # 21 In Vampire 7/10/2017 #28 In Vampire 28/09/2017 #31 In Vampire 27/09/2017 # 5 in Adventure 15/11/2018 #2 in Aventure 22/12/2018 #1 in Pureblood 27/12/2018 Complete Finish on 19/09/2017 ~Sequel: The hybrid Guardian~

More details