Story cover for Buried Deep by goldiel0ckss
Buried Deep
goldiel0ckss
  • WpView
    Reads 967
  • WpVote
    Votes 130
  • WpPart
    Parts 5
  • WpHistory
    Time 32m
  • WpView
    Reads 967
  • WpVote
    Votes 130
  • WpPart
    Parts 5
  • WpHistory
    Time 32m
goldiel0ckss
Ongoing, First published Oct 10, 2017
Mature
betrayalcheatingchrisbrownfriendsandfamilyfriendshipkehlanikehlaniparrishlovemarriageromanceselfhelpselfinjuryselflovetheheavenlyawards2018urbanurbanfictionurbanromance
My mother became very depressed but she wasn't like that for long. 

She had met this guy...

A guy we thought was perfect for her and us...

My mother and him got married and he started living with us.  

I thought he was going to change her life around and help her get through my father's death but that wasn't the case.

He changed...

He wasn't nice anymore...

He became my worst nightmare.

'Till this day he will always be the worse thing that ever happened to our family.

               amazing cover by: @theurbanroyalty

*WARNING BEFORE READING* the book consist of explicit scenes, inappropriate language, drugs and etc so please read at your own risk.

*MATURE AUDIENCE*

*I DO NOT OWN ANY COPYRIGHT TO THE MUSIC OR PICTURES BEING USED IN THIS BOOK WHATSOEVER*u
All Rights Reserved
betrayalcheatingchrisbrownfriendsandfamilyfriendshipkehlanikehlaniparrishlovemarriageromanceselfhelpselfinjuryselflovetheheavenlyawards2018urbanurbanfictionurbanromance
Table of contents

5 parts

Sign up to add Buried Deep to your library and receive updates
or
Content Guidelines
You may also like
His Substitute Wife {Book 2} (Completed) by MyraKapoor
33 parts Complete Mature
After years of ups and down, Ryan William is left all alone even though he's surround by a lot of people. Choosing his love over the girl everyone thought was perfect for him, costed him every thing and everyone he ever had. On the other side, Jennifer Jonas was left to fend for herself when she left her husband years ago after he betrayed her. Choosing one's sister over them never yields positive results and Ryan was now realizing it. But now, he had no one to share it with. Somehow, fate gives them another chance by setting them up on a journey they never knew would lead to each other. Will they accept the fate now or turn it down all over again even after finding out about the biggest secret that binds them together? Because, after all, if you leave someone for your love, you hardly get them back! Join into this journey with them to find out more about them!! *********** This story is in continuation with Part 1 of the same book. Although, you're free to read it all by itself as there are quite a lot of explanations hinting about the past between the protagonists. However, if you wish to get a better understanding of this novel, then I suggest you check out the Book 1 for the same. Link for book 1: https://www.wattpad.com/story/281481731?utm_source=android&utm_medium=link&utm_content=share_writing&wp_page=create&wp_uname=MyraKapoor&wp_originator=bfkbDw2lkgLDlYFERg%2FQ3BMeYcj6IJYSp29ed85vbHVc2cvt%2Bn%2B%2BFKOvfk%2BJku3A4Yh4ZGG5jLthgtBvScZKvdEtiWd8cy0ntalu3cwKDnIb%2FL7P%2FWTbHHyilsJr2OHh #His_Substitute_Wife_Book_1
𝐈 𝐃𝐎𝐍'𝐓 𝐁𝐄𝐋𝐈𝐄𝐕𝐄 𝐈𝐍 𝐏𝐄𝐑𝐅𝐄𝐂𝐓𝐈𝐎𝐍𝐒 ! (#3) by writingsbyrayy
54 parts Complete Mature
Vansh and Roshni are college friends. Vansh was a business man who had a bad childhood with his parents having a unhealthy relationship which made him not believe into marriage or love. Roshni was a fashion designer and a girl full of life but unlucky in relationship which didn't really bother her too much. When her best friend Aadhya got married, her mom started pressurizing her for marriage so she came up with a plan to escape this pressure. She decided to fake date with Vansh because he was the only guy from the group who was single. She thought that by doing this her Mom will have a guarantee that she will marry after few time and meanwhile she will come up with an idea to get rid of marriage but the tables are turned. Her mom now pressurize her double than before and now they have to marry each other. Roshni is not really happy about it but Vansh was because he liked her since college days but kept denying it. Both of their lives were never perfect and perfection was almost a myth for them. It's interesting to see how this marriage will turn a myth into a reality and how they fall for each other. Will this marriage be a success or will their marriage fail and break into million pieces? Note: This story contains smut. This story will make more sense if you have read the other two sequence of 'I don't believe' series. If you haven't then no worries it won't be a much problem.
Marked By You by yoitzher
58 parts Complete Mature
NOT EDITED PREPARE FOR SPELLING AND GRAMMAR MISTAKES; TRIGGER WARNING: I suck at putting them in the book so if you need one for any reason this is it. Be careful love:) ~~~~~~ Once you become addicted to something it never goes away. And that's what we are addicted. When addicted you'll do anything to get your next fix and for us that involved fighting, murder, and risking our lives just to see the other breathing. and even when your "sober" you'll always be addicted, that will always be your one true craving. That's exactly what happened too. We would set fire to the world around us and never let a flame touch the other because if we did... ... we'd destroy ourselves in the process. Simply I was marked by him And he was marked by me. ~~~~~ THANK YOU SO MUCH FOR GIVING MY BOOK A CHANCE. PLEASE VOTE AND COMMENT. I HOPE YOU ENJOY BABE:
Perfect Fate ✔ (Moved To Inkitt) by fanoshkaflippo
13 parts Complete Mature
Wattpad Creator! Happy and proud. HIM: Staying the night? Not my thing. Hearts and flowers? Boring. Falling in love? Not anytime soon. Settling down? Off the table. Getting married? You're kidding me, right? That was me before the night we first met. Because, well, meeting a hot chick that made me hard just by looking at her was definitely not in my plans when I sneaked out of a woman's apartment after what was already a long night. Taking her home and getting her a chocolate cake, though, was kind of intentional. But falling for her? Boy, that was pretty much inevitable. HER: He came out of nowhere, literally. I was there, sitting on that bench, barefoot and crying and just getting my heart broken in peace and silence. Then he appeared, all mad and furious and sexy and tall and just drool-worthy! And just like that, despite my poor attempts of escaping him, he had me wrapped in his world. A crazy yet heart-fluttering world, that I have absolutely no intentions of leaving anytime soon. ------- Character development is a main theme in this book. It shows you how they both work on changing for the better, while trying to overcome the obstacles in their relationship and fight for each other till the end. ** Warning!! Some chapters contain sexual scenes, but there's always a warning at the head of the chapter. Do not read them if you're under 18.** * Also, please beware that this story contains a lot of swearing. Read at your own risk. * **I don't own any photos used in this book. All are found on the internet for public use.** Highest Rankings: Sexy - #1 Love - #1 General Fiction - #41 Romance - #46 ------ ** Copyright © 2014 by Fanoshka Flippo (Farah Fekry). All rights reserved. No part of this document may be reproduced or transmitted in any form or by any means, electronic, mechanical, photocopying, recording, or otherwise, without prior written permission of Fanoshka Flippo / Farah Fekry. **
Destined By Fate by LoraWhite6
26 parts Complete Mature
Kendall has always lived a quiet life in a small town in Illinois with her family, friends, and boyfriend Jordan. Her life had been mostly happy other than when her best friend moved away when she was 10. It took her years to get over that loss. Then several years later, tragedy struck when her father passed away suddenly and Kendall was forced to move with her mom closer to Chicago where she could find a job to support the two of them. Little does Kendall know that she is in for the surprise of a lifetime. From the book.... As he catches up to me, he grabs my arm swings me around and with one swift movement he ushers me into a nearby empty classroom with the lights off. He cages me in against the wall. His close proximity is making me dizzy and my mind is thinking very dirty thoughts. Wait no. I can't think like that anymore. "Kendall." He says hungrily. "You are mine and only mine. You drive me wild and no one else can have you." He says as he attacks my lips. It feels so amazing I can't help but kiss him back. I run my hands through his beautiful hair and he groans into the kiss. Man I don't want this to ever end. I feel drunk on him. I don't think I can let him go. He stops suddenly to finish his thoughts. "No one can make you feel like this. Or kiss you here...." He says as he kisses down my neck. I moan and he smirks pulling his face impossibly close to mine. "..or touch you." He says as he takes his hand and brushes it lightly down my arm and he snakes it back around my back pulling me even closer if that is possible. He finally stops at my ass which he squeezes delightfully and I hum in response. Warning: Contains graphic sexual content. Read at your own discretion. You will not be warned ahead of time. This is your only warning.
Once upon a playboy ✓ (Spin-Off Of Far yet Closer) by Sanju_sharma
56 parts Complete Mature
When did you go on a vacation? And where have you gone for a vacation? And for how many days you have been on vacation? And.... What exactly.... Can happen... on a vacation? Wanna see what happened to our Michael when he went on a vacation? That too.... When he went on a vacation for 3 months..... Wink..... Let's dig into the story of our Once upon a Playboy. _________ Micheal A care free Playboy who has nothing but work and women in his life. But one day, one person changed everything. Steered away his carefree boat which brought back many things into his life. Like his parents, his family, his responsibilities and a steady woman - all of which he left previously. ____________ And no... I'm not going to reveal about our Micheal's woman. Wait and read the story for her... (⁠◠⁠‿⁠・⁠) ____________ I brought her into my world to let her spread her wings and fly high but I crumpled those little wings with my own mess. ____ All I thought of giving him is my love by bringing him into my world but all I have given him is humiliation with my own mess. _____ Cover credits : @Hummin--Bird--Love
My ex-boyfriends dad by houseoflosers
51 parts Ongoing Mature
Me and my boyfriend have been together for 4 years. Both of us were 20 and living our happiest lives(not really). My boyfriend, Keaton, had a father who was 42, Keaton didn't have a mother. I had a mother and no father my mom was 43. Me and Keaton had a amazing relationship for a while...until he started to act extremely Different, Half the time when I saw him he only wanted to make out, you see, I'm not a virgin because Keaton took my virginity but every time we have sex I just don't feel anything special in sex with him. Keatons dad, Mr or Lazlo Lake, was always kind to me..he didn't care that his son could be a Douche at times , he was still there for me. I had always thought that Mr. Lazlo was attracted to my mom because of how close they were at times. I was proven wrong.
Everything Hurts by analiciapaloma
10 parts Complete Mature
I knew what was coming later tonight, not only at home, but on the way there. I knew that reacting right now would just make it worse though. So I kept quiet and pretended that I was not dreading when I would be alone with the man that stood beside me, wondering when it became so normal to do so. Jason and Alicia have the perfect relationship from the outside looking in, but Alicia has kept her wounded spirit and body hidden well. After another one of Jason's violent rages that is impossible to hide, Alicia is finally able to get away from the abuse though. In the process of healing, she begins to relearn what trust, compassion, and safety are once again - that is, until Jason discovers her whereabouts. All Rights Reserved © Copyrights analiciapaloma 2014 © 2017 edits by Analicia Feliciano Book Cover Design by Analicia Feliciano (FIRST FOUR CHAPTERS *ORIGINAL AND UNEDITED* AVAILABLE HERE. PUBLISHED E-BOOK/PAPERBACK EDITION AVAILABLE ON AMAZON. LINK IN BIO.)
You may also like
Slide 1 of 8
His Substitute Wife {Book 2} (Completed) cover
𝐈 𝐃𝐎𝐍'𝐓 𝐁𝐄𝐋𝐈𝐄𝐕𝐄 𝐈𝐍 𝐏𝐄𝐑𝐅𝐄𝐂𝐓𝐈𝐎𝐍𝐒 ! (#3) cover
Marked By You cover
Perfect Fate ✔ (Moved To Inkitt) cover
Destined By Fate cover
Once upon a playboy ✓ (Spin-Off Of Far yet Closer) cover
My ex-boyfriends dad cover
Everything Hurts cover

His Substitute Wife {Book 2} (Completed)

33 parts Complete Mature

After years of ups and down, Ryan William is left all alone even though he's surround by a lot of people. Choosing his love over the girl everyone thought was perfect for him, costed him every thing and everyone he ever had. On the other side, Jennifer Jonas was left to fend for herself when she left her husband years ago after he betrayed her. Choosing one's sister over them never yields positive results and Ryan was now realizing it. But now, he had no one to share it with. Somehow, fate gives them another chance by setting them up on a journey they never knew would lead to each other. Will they accept the fate now or turn it down all over again even after finding out about the biggest secret that binds them together? Because, after all, if you leave someone for your love, you hardly get them back! Join into this journey with them to find out more about them!! *********** This story is in continuation with Part 1 of the same book. Although, you're free to read it all by itself as there are quite a lot of explanations hinting about the past between the protagonists. However, if you wish to get a better understanding of this novel, then I suggest you check out the Book 1 for the same. Link for book 1: https://www.wattpad.com/story/281481731?utm_source=android&utm_medium=link&utm_content=share_writing&wp_page=create&wp_uname=MyraKapoor&wp_originator=bfkbDw2lkgLDlYFERg%2FQ3BMeYcj6IJYSp29ed85vbHVc2cvt%2Bn%2B%2BFKOvfk%2BJku3A4Yh4ZGG5jLthgtBvScZKvdEtiWd8cy0ntalu3cwKDnIb%2FL7P%2FWTbHHyilsJr2OHh #His_Substitute_Wife_Book_1

More details