Story cover for Buried Deep by goldiel0ckss
Buried Deep
goldiel0ckss
  • WpView
    Reads 967
  • WpVote
    Votes 130
  • WpPart
    Parts 5
  • WpHistory
    Time 32m
  • WpView
    Reads 967
  • WpVote
    Votes 130
  • WpPart
    Parts 5
  • WpHistory
    Time 32m
goldiel0ckss
Ongoing, First published Oct 10, 2017
Mature
betrayalcheatingchrisbrownfriendsandfamilyfriendshipkehlanikehlaniparrishlovemarriageromanceselfhelpselfinjuryselflovetheheavenlyawards2018urbanurbanfictionurbanromance
My mother became very depressed but she wasn't like that for long. 

She had met this guy...

A guy we thought was perfect for her and us...

My mother and him got married and he started living with us.  

I thought he was going to change her life around and help her get through my father's death but that wasn't the case.

He changed...

He wasn't nice anymore...

He became my worst nightmare.

'Till this day he will always be the worse thing that ever happened to our family.

               amazing cover by: @theurbanroyalty

*WARNING BEFORE READING* the book consist of explicit scenes, inappropriate language, drugs and etc so please read at your own risk.

*MATURE AUDIENCE*

*I DO NOT OWN ANY COPYRIGHT TO THE MUSIC OR PICTURES BEING USED IN THIS BOOK WHATSOEVER*u
All Rights Reserved
betrayalcheatingchrisbrownfriendsandfamilyfriendshipkehlanikehlaniparrishlovemarriageromanceselfhelpselfinjuryselflovetheheavenlyawards2018urbanurbanfictionurbanromance
Table of contents

5 parts

Sign up to add Buried Deep to your library and receive updates
or
Content Guidelines
You may also like
Marked By You by yoitzher
58 parts Complete Mature
NOT EDITED PREPARE FOR SPELLING AND GRAMMAR MISTAKES; TRIGGER WARNING: I suck at putting them in the book so if you need one for any reason this is it. Be careful love:) ~~~~~~ Once you become addicted to something it never goes away. And that's what we are addicted. When addicted you'll do anything to get your next fix and for us that involved fighting, murder, and risking our lives just to see the other breathing. and even when your "sober" you'll always be addicted, that will always be your one true craving. That's exactly what happened too. We would set fire to the world around us and never let a flame touch the other because if we did... ... we'd destroy ourselves in the process. Simply I was marked by him And he was marked by me. ~~~~~ THANK YOU SO MUCH FOR GIVING MY BOOK A CHANCE. PLEASE VOTE AND COMMENT. I HOPE YOU ENJOY BABE:
𝐈 𝐃𝐎𝐍'𝐓 𝐁𝐄𝐋𝐈𝐄𝐕𝐄 𝐈𝐍 𝐏𝐄𝐑𝐅𝐄𝐂𝐓𝐈𝐎𝐍𝐒 ! (#3) by writingsbyrayy
54 parts Complete Mature
Vansh and Roshni are college friends. Vansh was a business man who had a bad childhood with his parents having a unhealthy relationship which made him not believe into marriage or love. Roshni was a fashion designer and a girl full of life but unlucky in relationship which didn't really bother her too much. When her best friend Aadhya got married, her mom started pressurizing her for marriage so she came up with a plan to escape this pressure. She decided to fake date with Vansh because he was the only guy from the group who was single. She thought that by doing this her Mom will have a guarantee that she will marry after few time and meanwhile she will come up with an idea to get rid of marriage but the tables are turned. Her mom now pressurize her double than before and now they have to marry each other. Roshni is not really happy about it but Vansh was because he liked her since college days but kept denying it. Both of their lives were never perfect and perfection was almost a myth for them. It's interesting to see how this marriage will turn a myth into a reality and how they fall for each other. Will this marriage be a success or will their marriage fail and break into million pieces? Note: This story contains smut. This story will make more sense if you have read the other two sequence of 'I don't believe' series. If you haven't then no worries it won't be a much problem.
Once upon a playboy ✓ (Spin-Off Of Far yet Closer) by Sanju_sharma
56 parts Complete Mature
When did you go on a vacation? And where have you gone for a vacation? And for how many days you have been on vacation? And.... What exactly.... Can happen... on a vacation? Wanna see what happened to our Michael when he went on a vacation? That too.... When he went on a vacation for 3 months..... Wink..... Let's dig into the story of our Once upon a Playboy. _________ Micheal A care free Playboy who has nothing but work and women in his life. But one day, one person changed everything. Steered away his carefree boat which brought back many things into his life. Like his parents, his family, his responsibilities and a steady woman - all of which he left previously. ____________ And no... I'm not going to reveal about our Micheal's woman. Wait and read the story for her... (⁠◠⁠‿⁠・⁠) ____________ I brought her into my world to let her spread her wings and fly high but I crumpled those little wings with my own mess. ____ All I thought of giving him is my love by bringing him into my world but all I have given him is humiliation with my own mess. _____ Cover credits : @Hummin--Bird--Love
We're Just Friends [BOOK 1 Of The 'We're Just' Trilogy]] by Riane_Pereira
41 parts Complete Mature
They say all good boys go to heaven, but bad boys bring heaven to you. And that's what he brought me, Heaven. We were terribly perfect for each other. We'd argue, we'd scream- hell we'd throw things at each other. But at the end of the night we'd lay beside each other. What started off as a silly deal to get us both going ended up as so much more than i could've ever imagined... He was the worst best thing that happened to me, but our dark pasts ruined us. We took dying for each other a little too literal. "You say we're just friends but i swear, when nobody's around..." Started: April 4th 2018 Ended: July 23rd 2020 WARNING: Contains mature scenes, Strong abusive language. Mentions of rape, sex, murder, alcohol and violence. READ AT YOUR OWN DISCRETION. BOOK WILL GO UNDER A ROUND OF REVISION AFTER ITS FULLY PUBLISHED TO MAKE SURE READING IS A SMOOTH SAIL FOR EVERYONE. I'm also sorry for any stones i've left unturned in the book!!! I'll be working on fixing them asap. Until then I'm extremely sorry for any mistakes. ANY SIMILARITIES IN REGARDS TO NAMES, LOCATIONS AND SCENES IN OTHER BOOKS IS PURE COINCIDENCE! Thank you!
Sunset At Sarsen Stones (What Dreams Are Made Of) by AnnaRamakson
56 parts Complete
Earlier Name - What Dreams Are Made Of (WDAMO) 'And he covered her lips completely with his. Chrissy was too shocked to realize what was happening. She hated this man with all her guts and he had always returned the favor. Uptil now. So what has changed now? Nikloi Swaroski, her worst enemy ever, was kissing her!' Meet Chrissy, Christina Smith. Girl who couldn't have imagined in her wildest dreams that Nikloi Swaroski or for that matter any man would kiss her. She was not the one to make men's head turn. Hell, she was not even stared at! Meet Nikloi Swaroski. Cold, hard and ruthless businessman who knew only one thing. How to make money. And he knew it well. Not the one to waste time on girls or their romantic liaisons. So why was he kissing her? ******************************************** Readers' Reviews & Comments RuthEreh3 Thanks for this book, it inspired me to love again. In all my years I have been on wattpad, this is my best novel ever. It kept me glued to my phone. Hope to see more works from you....... You got my vote always. Nabilahhh30 Honestly one of the best books I've ever read :) Thank you so much for creating such an amazing book !! nimmys Hey Anna, i loved your work so much. You have amazingly carried the story at the end. I am happy i found this story. Best wishes for your other stories too. nainanayan I really likr your story.. it was awsm.. and I read whole in one day only jessicafongyee409 It's a wonderful book Keep up the good work #4 Romance since 19th October 2019 ************************************************* I am a diehard romantic and guess what, my first story happens to be a romance :) While there is nothing wrong with any other category, romance is Numero Uno for me. Go ahead. Read my story and find out why. And during the discovery, don't forget to enjoy Chrissy and Nikloi's lives.
His Substitute Wife {Book 2} (Completed) by MyraKapoor
33 parts Complete Mature
After years of ups and down, Ryan William is left all alone even though he's surround by a lot of people. Choosing his love over the girl everyone thought was perfect for him, costed him every thing and everyone he ever had. On the other side, Jennifer Jonas was left to fend for herself when she left her husband years ago after he betrayed her. Choosing one's sister over them never yields positive results and Ryan was now realizing it. But now, he had no one to share it with. Somehow, fate gives them another chance by setting them up on a journey they never knew would lead to each other. Will they accept the fate now or turn it down all over again even after finding out about the biggest secret that binds them together? Because, after all, if you leave someone for your love, you hardly get them back! Join into this journey with them to find out more about them!! *********** This story is in continuation with Part 1 of the same book. Although, you're free to read it all by itself as there are quite a lot of explanations hinting about the past between the protagonists. However, if you wish to get a better understanding of this novel, then I suggest you check out the Book 1 for the same. Link for book 1: https://www.wattpad.com/story/281481731?utm_source=android&utm_medium=link&utm_content=share_writing&wp_page=create&wp_uname=MyraKapoor&wp_originator=bfkbDw2lkgLDlYFERg%2FQ3BMeYcj6IJYSp29ed85vbHVc2cvt%2Bn%2B%2BFKOvfk%2BJku3A4Yh4ZGG5jLthgtBvScZKvdEtiWd8cy0ntalu3cwKDnIb%2FL7P%2FWTbHHyilsJr2OHh #His_Substitute_Wife_Book_1
... by monica23031
35 parts Complete Mature
Everything Hurts by analiciapaloma
10 parts Complete Mature
I knew what was coming later tonight, not only at home, but on the way there. I knew that reacting right now would just make it worse though. So I kept quiet and pretended that I was not dreading when I would be alone with the man that stood beside me, wondering when it became so normal to do so. Jason and Alicia have the perfect relationship from the outside looking in, but Alicia has kept her wounded spirit and body hidden well. After another one of Jason's violent rages that is impossible to hide, Alicia is finally able to get away from the abuse though. In the process of healing, she begins to relearn what trust, compassion, and safety are once again - that is, until Jason discovers her whereabouts. All Rights Reserved © Copyrights analiciapaloma 2014 © 2017 edits by Analicia Feliciano Book Cover Design by Analicia Feliciano (FIRST FOUR CHAPTERS *ORIGINAL AND UNEDITED* AVAILABLE HERE. PUBLISHED E-BOOK/PAPERBACK EDITION AVAILABLE ON AMAZON. LINK IN BIO.)
You may also like
Slide 1 of 8
Marked By You cover
𝐈 𝐃𝐎𝐍'𝐓 𝐁𝐄𝐋𝐈𝐄𝐕𝐄 𝐈𝐍 𝐏𝐄𝐑𝐅𝐄𝐂𝐓𝐈𝐎𝐍𝐒 ! (#3) cover
Once upon a playboy ✓ (Spin-Off Of Far yet Closer) cover
We're Just Friends [BOOK 1 Of The 'We're Just' Trilogy]] cover
Sunset At Sarsen Stones (What Dreams Are Made Of) cover
His Substitute Wife {Book 2} (Completed) cover
... cover
Everything Hurts cover

Marked By You

58 parts Complete Mature

NOT EDITED PREPARE FOR SPELLING AND GRAMMAR MISTAKES; TRIGGER WARNING: I suck at putting them in the book so if you need one for any reason this is it. Be careful love:) ~~~~~~ Once you become addicted to something it never goes away. And that's what we are addicted. When addicted you'll do anything to get your next fix and for us that involved fighting, murder, and risking our lives just to see the other breathing. and even when your "sober" you'll always be addicted, that will always be your one true craving. That's exactly what happened too. We would set fire to the world around us and never let a flame touch the other because if we did... ... we'd destroy ourselves in the process. Simply I was marked by him And he was marked by me. ~~~~~ THANK YOU SO MUCH FOR GIVING MY BOOK A CHANCE. PLEASE VOTE AND COMMENT. I HOPE YOU ENJOY BABE:

More details