The Act of Infidelity
tonguetiedbabe
  • LECTURAS 175,139
  • Votos 2,582
  • Partes 16
  • LECTURAS 175,139
  • Votos 2,582
  • Partes 16
tonguetiedbabe
Concluida, Has publicado jul 20, 2012
Contenido adulto
betrayalbrokenmarriagefriendshiphiddendesirehiddenfeelingsinfidelitymarriagenewadultromancesecrets
Why give up the man you love
when you know he was yours in the first place? 
It's never been easy for Cynthia.
Life has been one tough choice for her
especially now, the man she secretly loves
..  is already married to her bestfriend.
Todos los derechos reservados
betrayalbrokenmarriagefriendshiphiddendesirehiddenfeelingsinfidelitymarriagenewadultromancesecrets
Tabla de contenidos

16 partes

Regístrate para añadir The Act of Infidelity a tu biblioteca y recibir actualizaciones
O
Pautas de Contenido
Quizás también te guste
Palawan: As Told by Douglas de Imcrazyyouknow
34 Partes Concluida
Let's travel Palawan in Douglas' eyes. Douglas Alejandria, a son of Cuyo's Vice Mayor, decided to leave their hometown and live alone and work his ass out to live in Coron. It was all good until one tourist came and changes the course of the world for him. *** When Douglas decided to leave his hometown-Cuyo and live in Coron after finishing college, he spend his life diving down under the sea showing people the wonder of Palawan. But what people do not know, is what does Douglas pursue living alone in Palawan? And how does this eventually lead to meeting a traveler from Manila named Cory? Will it be chaos or they are about to see the stunning wonders of Palawan?
When Love Makes A Mistake (Book 2 of WL Trilogy) (ML, #2) de frappiness
44 Partes Concluida
Leigh Alegre chose to run away. Pinili niyang iwan ang taong nagbigay sa kanya ng pagkakataong sumaya't magmahal. Pinili niyang pakawalan ito dahil alam niyang mali. She thought his love was wrong for her. And her love wasn't enough to fight for the tireless love he offered. Ngayo'y nagbalik na siya, ayaw na ni Leigh na may masaktan pa. She doesn't want to commit a mistake. Pero mapipigilan ba niyang hindi magkamali kung natukoy na niya ang nararamdaman? Is she ready to commit a mistake for him...for this love? Magpapatuloy pa rin kaya ang pag-ibig na naging mali sa umpisa pa lang? O huli na ang lahat dahil napagod na ang pag-ibig na inaasam niya?
Ain't No Other de JFstories
35 Partes Concluida
Still aching from her internet ex-boyfriend's scam, Tamitha finds herself in deep trouble when she meets Roosevelt Sanvictores, the man in the photos her ex pretended to be. She knows that he's off-limits, but when circumstances keep bringing them together, maybe fate's got other plans. **** After getting drunk from a stupid mistake, Swan Tamitha Dominica wakes up in a room that's not hers, stark naked. As she tries to move forward from the humiliating one-night stand, she comes face-to-face with the man whose photo her internet boyfriend used to scam her. The man is Roosevelt Sanvictores, a handsome billionaire and it's not difficult to like him--only if he's not off limits. Determined not to fall for him, Tamitha puts up her walls. But when her heart screams to tear her walls down and she discovers the past she shared with Roosevelt, will she finally listen to her heart? Disclaimer: This story is written in Taglish.
When Love Goes Wrong (Book 1 of WL Trilogy) (ML, #1) de frappiness
53 Partes Concluida
Leigh Scarlett Alegre has everything she needed. Materyal na bagay, pera, at edukasyon. Naging marangya ang buhay niya dahil naiibigay sa kanya ang lahat. Pero ang lahat ng binigay sa kanya'y may kapalit pala. Wala naman siyang magagawa tungkol dito dahil parehas nakakadena ang kamay niya sa tabi ng pamilya niya. So she can't decide in her own. But when she gets the chance to be free, Scarlett found her own happiness. Naging malapit siya sa isang lalaking nagbigay sa kanya ng pagkakataon magmahal. Ngunit nagmahal lang ba sila para makatakas sa tanikalang nakakabit sa kanila? Paano kung mali ang pag-ibig na mayroon sa kanila? And the world is against to them? Are they going to stay when love goes wrong?
Crash (SC, #0.5; ARTL, #1) de frappiness
38 Partes Concluida
Nathalie Torres was attracted to Harry Jimenez. No, it wasn't just an attraction. It was an unexpected feelings hit her directly. A young love made her smitten so bad. She'd done everything for Harry to notice her. But it wasn't enough. It was a rejection from him. It was always a rejection. Harry didn't want her...she guess. Ngunit para kay Nathalie hindi naging hadlang iyon. Ginawa niya lahat, even risking her heart and body. She put down her defenses so easily that made her heart ripped out of her body. She'd crashed her heart and dignity. But those were still not enough. How to love someone dearly without laying your heart on the line? Without pain? Without getting hurt? How to love without sacrifices? How to not crash your heart again? How...
Hooked (ML, #2.5) de frappiness
38 Partes Concluida
Lana Marjorie del Rey refused to be a puppet of a world she doesn't admire. She was tired of being not herself anymore. She destroyed the image they'd pictured of her. She could no longer pretend to be someone who she's not. Ayaw na niyang ikulong ang sarili sa mga bagay na kailanman ay walang kaligayahan sa kanya. So, she freed herself withthose things. But some people couldn't get her, they can't accept the experimental Lana. That caused trouble. She felt guilty on the damage she'd made. Bumawi siya upang tulungan ang isang tao. But as Lana freeing herself and doing a task, she didn't expect something could happen on her quest. Something she's gonna be hooked.
Bitter Holidays in Jeju de Imcrazyyouknow
40 Partes Concluida
World Trip Series 6 Previously working as a personal assistant, Raijine was called back to work to this popular Korean superstar after being enlisted into the military. After 18 months away from South Korea, what goes bloom to a new chapter of their lives? Would it be bitter or a sweet success? *** For a year, Raijine works as a personal assistant to a popular Korean actor and singer. She loves her job so much she thought it'll be her life forever, but it ended when her boss got enlisted in compulsory military training. She was left with no job and had to go back home and do part-time jobs, and after 18 long months, she was called to fill in the job she left almost two years ago. What would happen now when her life will begin in South Korea one more time? Disclaimer: The story is written in Tagalog and English with a little bit of Hangul.
The Wrong Kind Of Right (Vexed Men Series #4) de kjeandvcki
63 Partes Concluida
Maxiann "Max" Demarco, a gay man art professor, still licking his wounds from a devastating breakup with a man who left him angry and betrayed, is done with love. Pinag palit siya sa isang babae, kaya galit siya sa mga ito, pero paano kung may babae siyang estudyante na makakapagpa-bago sa galit na nararamdaman? With Stesia Andrade's joyful spirit and vibrant energy, she lights up the room in ways he never expected and stirs something in him that he's never allowed himself to feel. Can he deny the truth in his heart when it's telling him something he swore he'd never feel? Fourth Book Of Vexed Men Series. Dual Point Of View.
Miss Kae's List of Stories de KaeJune
5 Partes Continúa
Miss Kae's list of stories and their sequence. I compiled all my stories for easy search and if you want to know the order of reading for my series. Happy reading! ♥️
Lost (Salazar Siblings Series #1) de chameeyotch
55 Partes Concluida
The original plan was to make Ethan Adrian Salazar fall for her. Unfortunately, she was dumped. But Natalie Chase Alejo will never give up. Kaya naman nang matupad na ang kaniyang pinapangarap ay abot langit ang kaligayahan niya. Hindi niya lubos mapaniwalaan na ang lalaking Salazar mismo ang susuko sa kanya. But everything was ruined when she was exposed from the truth. A truth that she never knew existed a long time ago. The least that she could do is to fight right? To try until the end. But how can she fight if everyone's telling her to stop. How can she fight a battle she knew she would lose? Most importantly, how can she fight if her winning, would mean that she would lose him forever? Love, family, friends? Ano ang uunahin niya? Sino ang iiwan niya para sa isa? Does she really have a choice? Or getting lost is the only choice she has?
Quizás también te guste
Slide 1 of 10
Palawan: As Told by Douglas cover
When Love Makes A Mistake (Book 2 of WL Trilogy) (ML, #2) cover
Ain't No Other cover
When Love Goes Wrong (Book 1 of WL Trilogy) (ML, #1) cover
Crash (SC, #0.5; ARTL, #1) cover
Hooked (ML, #2.5) cover
Bitter Holidays in Jeju cover
The Wrong Kind Of Right (Vexed Men Series #4) cover
Miss Kae's List of Stories cover
Lost (Salazar Siblings Series #1) cover

Palawan: As Told by Douglas

34 Partes Concluida

Let's travel Palawan in Douglas' eyes. Douglas Alejandria, a son of Cuyo's Vice Mayor, decided to leave their hometown and live alone and work his ass out to live in Coron. It was all good until one tourist came and changes the course of the world for him. *** When Douglas decided to leave his hometown-Cuyo and live in Coron after finishing college, he spend his life diving down under the sea showing people the wonder of Palawan. But what people do not know, is what does Douglas pursue living alone in Palawan? And how does this eventually lead to meeting a traveler from Manila named Cory? Will it be chaos or they are about to see the stunning wonders of Palawan?

Más detalles