My Marvel Theories (Requests Open)
AlyxGarcia01
  • Reads 116
  • Votes 3
  • Parts 4
  • Time 12m
  • Reads 116
  • Votes 3
  • Parts 4
  • Time 12m
AlyxGarcia01
Ongoing, First published Nov 03, 2017
agentsofshieldavengersendgameinfinitywarinhumansmarveltheories
This is a compilation of my theories on things in the marvel cinematic universe. Most of my theories include nothing from the comic books or spin-off cartoon recreations. If you find something that is missing from my theory that you believe is important to add, write a comment or message me.
Public Domain
agentsofshieldavengersendgameinfinitywarinhumansmarveltheories
Table of contents

4 parts

Sign up to add My Marvel Theories (Requests Open) to your library and receive updates
or
#462inhumans
Content Guidelines
You may also like
Wendizzy's Writer Room by Wendizzy
2 parts Ongoing
In this book, you'll get a behind the scenes look at how your favorite characters were born, my creative process, and the dirty details never before revealed. Tex's Camp Q&A: Come sit by the fire and ask me whatever you'd like. We can roast marshmallows, tell scary stories, and hang out in the comments like a big, happy family. Gator's Backstage Pass: A place full of secrets. Learn the-sometimes embarrassing-details on how my wildest scenes came to life, facts about the characters, the process, and myself.
You may also like
Slide 1 of 1
Wendizzy's Writer Room cover

Wendizzy's Writer Room

2 parts Ongoing

In this book, you'll get a behind the scenes look at how your favorite characters were born, my creative process, and the dirty details never before revealed. Tex's Camp Q&A: Come sit by the fire and ask me whatever you'd like. We can roast marshmallows, tell scary stories, and hang out in the comments like a big, happy family. Gator's Backstage Pass: A place full of secrets. Learn the-sometimes embarrassing-details on how my wildest scenes came to life, facts about the characters, the process, and myself.

More details