Aphmau Memes 2
mars8131
  • Reads 26,259
  • Votes 915
  • Parts 92
  • Time <5 mins
  • Reads 26,259
  • Votes 915
  • Parts 92
  • Time <5 mins
mars8131
Complete, First published Dec 03, 2017
angelsvilleaphmaufalconclawuniversityfculoveloveparadisemcdmemememesminecraftdiariesmycraftmystreetpdhphoenixdrophighrandomstarlightwonderland
Another book of Aphmau memes. Could this be better than the first one? Probably not, BUT it could be. It has POTENTIAL.

   Status: 
     Completed
   Last Updated: 
      February 9, 2020

Please note that all memes in this book don't belong to me. They belong to their respective owners. Found all of them on Google Images and Pinterest.
Public Domain
angelsvilleaphmaufalconclawuniversityfculoveloveparadisemcdmemememesminecraftdiariesmycraftmystreetpdhphoenixdrophighrandomstarlightwonderland
Table of contents

92 parts

Sign up to add Aphmau Memes 2 to your library and receive updates
or
#356pdh
Content Guidelines
You may also like
Little Bella by SaRa_2_Ghostwriter
40 parts Ongoing
Mafia ; The word itself expresses fear , danger and mostly DEATH . What happens when one day the capo of the most feared mafia , Leonardo Russo , meets the little shy, smart and sweet Bella , who herself is a mystery . Bella is just like her name beautiful but this little miss sunshine's existence is enigma. Will this sunshine brighten the Russo world or will she remain an enigma ?? Let's grasp the story of Bella ( Russo's princess 😉 ) . #1 in lovable ♡♡ #1 in Older brothers ♡♡ #1 in father- daughter ♡♡ #1 in 3 years old ♡♡ #1 in lost daughter ♡♡ #1 in only daughter ♡♡
Admirer With Curly Hair {Rikey} by _drowninglessons_
12 parts Complete
Meet Mikey Way, a guy who hates basically everyone, wants murder on a daily basis and loves astronomy. He starts his first day of grade 10... horribly. Mikey isn't a person to have many friends, or even communicate with people for that matter. But all of that changes when Mikey meets Ray Toro. An intelligent, ray of sunshine who is loving, caring and a total sweetheart. Mikey then realizes that in these special moments he's spent with Ray, he's found his admirer (with curly hair.)
𝐵𝑎𝑠𝑘𝑒𝑡𝑏𝑎𝑙𝑙 𝐿𝑜𝑣𝑒 ~𝐿𝑢𝑚𝑎𝑥 by justanwannabewriter
11 parts Complete
18+, Max and Lucas knew each other when they were younger but stopped being friends due to some circumstances, they are in college now, things get awkwardly romantic.
Wendizzy's Writer Room by Wendizzy
2 parts Ongoing
In this book, you'll get a behind the scenes look at how your favorite characters were born, my creative process, and the dirty details never before revealed. Tex's Camp Q&A: Come sit by the fire and ask me whatever you'd like. We can roast marshmallows, tell scary stories, and hang out in the comments like a big, happy family. Gator's Backstage Pass: A place full of secrets. Learn the-sometimes embarrassing-details on how my wildest scenes came to life, facts about the characters, the process, and myself.
What if? by wests_barry
13 parts Complete
AU set during the season 3 finale. What if Iris was pregnant and she found out a day before she was about to be killed? Barry saves her but will that keep him from entering the speedforce. Most likely a regular story. Re - editing is finished
Community Happenings by Wattpad
57 parts Ongoing
Welcome to The Wattpad HQ Community Happenings story! We are so glad you're part of our global community. This is the place for readers and writers to come to discover all the things we're doing to keep our community connected and inspired. From writer prompts to keep you motivated to weekly reading challenges, you'll find it all here.
You & Me | jukyu by strawverymilktae
5 parts Ongoing
❝ Together we explode like fireworks ❞ A twist of fate causes childhood classmates to meet again at the university's dance club as they fight for their dreams while facing difficulties surfacing again from the past. ***** Ji Changmin never gave up chasing after his dream but it stays as one the moment he falls into the darkness. Uncertain of the path he should follow as demons pull him down, an angel appears in the figure of a dance prodigy, Lee Juyeon. With a hint of admiration, he attempts to burn the shadows behind by incandescing light like the sun, hoping the lionhearted boy he once knew will break free and do what he loves best, dance. "Yeah, sure," Changmin says, tearing his gaze down. He can't help the small smile slipping across his face because of how stupid he is to forget something important. Dark colors of yarn twisted together sitting on his best friend's palm making its way around his wrist, gentle fingers brushing against the skin there. Juyeon would laugh but for some reason, he doesn't. "Dancing will come back to you and stay if you're determined just like how we did when we met again." update schedule: tba inspired yet heavily similar to the c-drama skate into love throughout the fic, but there will be moments from my imagination and other inspirations. university childhood sweethearts chase after their dreams au | jukyu (juyeon + changmin) story by me © strawverymilktae + chu yui bun, gu zhi wei cover by © strawverymilktae milestone: 1k: 1/21/20
HELLHOUND - Supernatural by littledixonslight
46 parts Ongoing
IN WHICH, an infamous 'demonic pitbull' shifter changes her ways for the better and continues to grip onto the final strings of her humanity, unlike other demons that want her dead. And somehow, ends up in the arms of a certain hunter, who overtime finds it difficult to control himself around her after admitting that maybe.. not all demons deserve to be demons. -Forbidden Romance. [mid season 2 - onwards]
the babysitter by Bella09980
49 parts Ongoing
"can't, i'm too busy babysitting."
𝗗𝗔𝗥𝗘 𝗘𝗡𝗧𝗘𝗥𝗧𝗔𝗜𝗡𝗠𝗘𝗡𝗧 | ent. applyfic by OceanCarat0211
27 parts Ongoing
✧₊⁺ 𝗢𝗣𝗘𝗡 𝗙𝗢𝗥 𝗔𝗣𝗣𝗟𝗜𝗖𝗔𝗧𝗜𝗢𝗡𝗦
You may also like
Slide 1 of 10
Little Bella cover
Admirer With Curly Hair {Rikey} cover
𝐵𝑎𝑠𝑘𝑒𝑡𝑏𝑎𝑙𝑙 𝐿𝑜𝑣𝑒 ~𝐿𝑢𝑚𝑎𝑥 cover
Wendizzy's Writer Room cover
What if? cover
Community Happenings cover
You & Me | jukyu cover
HELLHOUND - Supernatural cover
the babysitter cover
𝗗𝗔𝗥𝗘 𝗘𝗡𝗧𝗘𝗥𝗧𝗔𝗜𝗡𝗠𝗘𝗡𝗧 | ent. applyfic cover

Little Bella

40 parts Ongoing

Mafia ; The word itself expresses fear , danger and mostly DEATH . What happens when one day the capo of the most feared mafia , Leonardo Russo , meets the little shy, smart and sweet Bella , who herself is a mystery . Bella is just like her name beautiful but this little miss sunshine's existence is enigma. Will this sunshine brighten the Russo world or will she remain an enigma ?? Let's grasp the story of Bella ( Russo's princess 😉 ) . #1 in lovable ♡♡ #1 in Older brothers ♡♡ #1 in father- daughter ♡♡ #1 in 3 years old ♡♡ #1 in lost daughter ♡♡ #1 in only daughter ♡♡

More details