Story cover for Aphmau Memes 2 by mars8131
Aphmau Memes 2
mars8131
  • WpView
    Reads 26,792
  • WpVote
    Votes 915
  • WpPart
    Parts 92
  • WpHistory
    Time <5 mins
  • WpView
    Reads 26,792
  • WpVote
    Votes 915
  • WpPart
    Parts 92
  • WpHistory
    Time <5 mins
mars8131
Complete, First published Dec 03, 2017
angelsvilleaphmaufalconclawuniversityfculoveloveparadisemcdmemememesminecraftdiariesmycraftmystreetpdhphoenixdrophighrandomstarlightwonderland
Another book of Aphmau memes. Could this be better than the first one? Probably not, BUT it could be. It has POTENTIAL.

   Status: 
     Completed
   Last Updated: 
      February 9, 2020

Please note that all memes in this book don't belong to me. They belong to their respective owners. Found all of them on Google Images and Pinterest.
Public Domain
angelsvilleaphmaufalconclawuniversityfculoveloveparadisemcdmemememesminecraftdiariesmycraftmystreetpdhphoenixdrophighrandomstarlightwonderland
Table of contents

92 parts

Sign up to add Aphmau Memes 2 to your library and receive updates
or
#2falconclawuniversity
Content Guidelines
You may also like
Besties 2 Couples by Angel_MLoves
32 parts Complete
It's been a week since High school began. You were a total loner that was before your bestie, Vylad Ro'Meave, appeared. You and Vylad have gotten closer ever since his transfer. You discovered answers. Answers that answers your questions when you were a child. However, you didn't expect to discover Vylad's feelings. •~•~•~• - Vulgar language - This is Book 1. Book 2 is Always Together - Characters, excluding OC and her family, belongs to Aphmau (YT) or @Empress_Aphmau (Wattpad) •~•~•~•
Dominant【Gene X Reader】[ Completed ] by Mariko_Akiyama
32 parts Complete Mature
CONTENT CONTAINS : SEXUAL CONTENT DRUG USE VIOLENCE & STRONG LANGUAGE IF YOUR EASILY TRIGGERED OR UNCOMFORTABLE, DO NOT READ!! • " The nerve! " " What the hell did I just got myself into? " " How's my phone? " " 14 missed calls " " More pop tarts? " " Do you think it was a mistake? " " What is? " " The fact that I slept with him " " Well. . . .wait what?! " " I know! " " What?!, When?!, Where?!, Why?!, And how?! " • As the average savage adult that I am, I can be very serious with my work and words, but that happens exactly right after the death of my father, or so I thought. My brothers and I have been getting along very well, as a Bounty Hunter, I can be very intimidating, until I met him. His hair, his eyes, his touch is all I need, I never thought all that of him can make me feel like this and to my surprise, I act like a child. I was just no longer that average savage adult that I was, but everything changed when I learned about his past. I couldn't believe it nor could I even want to, it was overwhelming. I was lost, confused, it got to the point where I wasn't myself for a while. But the fun part is being Dominant. What's that supposed to mean?, What past did this person learn?, Is the father dead or alive?, Who's more dominant?, In what way? Read this book to know. Credit : To a game called 'PUBG' [ Completed ] Started : 1st January 2021 Finished : 24th March 2021 [ Highest Ranking : #6 in Aphmau ] [ #1 in Gene ] [ #1 in Gene x Reader ] Disclaimers : I do not own ANY of the characters only the ideas, they belong to a youtuber called Aphmau, I don't own any of the songs either or the pictures, except Y/n, it belongs to you. There are a few characters that I OWN. My OC : Xelora Kiselyov Catherine Fox Ash Lee Mandrell Natalie Rosetta Mandrell Coraline Alycia Jones Mariko Akiyama
He Loves Me【Zane X Reader】[ Completed ] by Mariko_Akiyama
34 parts Complete Mature
CONTENT CONTAINS : SELF HARM SUICIDAL THOUGHTS DRUG USE & STRONG LANGUAGE IF YOU'RE EASILY TRIGGERED OR UNCOMFORTABLE, DO NOT READ!! • " But your so cold to me sometimes " " I have anger issues " " From now on, can we like, be more than friends? " " Like, we're dating? " " Of course " • I was put in the orphanage by mistake, I always think my parents abandoned me for no reason, I usually get bullied at school. Calling me names and other stuff. It hurts to hear those words, so I have to do something to numb them. Cutting is all I can think of. Sneaking out at night is what I do mostly. Now my adoptive parents are sending me to collage, I can't sneak out anymore. Which takes all the fun away. I met a few kids that are nice, but I sometimes ignore them. I just treat them coldly until I got to know them better, and for the bullies, I do payback's. No one cares about me, actually one guys does, but he doesn't only care about me, He loves me. Who is this guy?, what makes him lover her?, will she ever find out?, will they have a happy ending? Read this book to know. [ Completed ] Started : 20th January 2019. Finished : 18th June 2019. [ Highest Ranking : #1 in Aphmau ] [ #13 in Zane ] [ #1 in Zane X Reader ] [ #3 in He Loves Me ] Disclaimers : I do not own ANY of the characters only the ideas, they belong to a youtuber called Aphmau, I don't own any of the songs either or the pictures, except Y/n, it belongs to you. There are a few characters that I OWN. My OC : Xelora Kiselyov Catherine Fox Ash Lee Mandrell Natalie Rosetta Mandrell Coraline Alycia Jones Mariko Akiyama
A New Experience (A Mystreet/Phoenix Drop High Fanfic) {Discontinued} by Meatballsparkle
18 parts Complete
Please keep in mind, I was a preteen when this book was being written. No changes have been made, and there are many unanswered questions that even I don't have the answer to. Renee decides to move from her old neighborhood due a few more families moving there. She leaves all her friends from Kindergarden all the way to the 9th grade behind, but summer is almost over so Renee lives on Mystreet and goes to school at Phoenix Drop High!! Most Impressive Ranking: #738 on #vylad
In This Together - Percabeth One Shots by what-could-have-been
42 parts Complete
A series of Percabeth one-shots. AU chapters, as well as non-AU chapters, obviously. WARNING: THERE MAY BE CURSE WORDS IN SOME CHAPTERS. BE CAREFUL IF YOU DON'T LIKE PROFANITY.
MCD X Reader! Sad One Shots~ by TheFoodAddicts
30 parts Complete Mature
You've seen the good, the bad, so now, let's add some sadness. If you wanna cry, tear up, or see if you can man through these one shots like a boss, then read on. These one shots will contain some swearing, suicidal themes, etc. You've been warned. ****** HEYYY! Alyssa~Chan has been writing One shots for a while, so I decided I'd give it a go. But I'm going to add my own twist. Mine will be filled with morbid, sad, and down right depressing one shots of your favorite characters. Drop some ideas down below!
What Will Become Of Us? [REMAKE] by SkytheShadowSword
31 parts Complete
A werewolf girl named Y/N transfers into Phoenix Drop High. What kind of friends will she make at this new school? What shenanigans will she find herself in? What sort of drama will unfold? [UPDATED] An Aaron x reader x Gene. An Aphmau based x reader. [BOOK 1] BOOK 2: All Good Things Come To An End BOOK 3: Everything Will Be Alright [COMPLETED] [Started: June 7, 2024] [Finished: January 28, 2025]
RANTS GALORE AND RANDOM APHMAU STUFF ✓ - Book 1 by ShinyLaurLaur
150 parts Complete
Welcome to.... *Drum Roll* The Rants and Random stuff book! This is a book where I basically talk about random stuff, mostly Aphmau, a Minecraft Youtuber with roleplays. I will also be talking about some other stuff. (• ε •) Her channel: https://www.youtube.com/user/ChallengeAcceptedInc | Enjoi! :P RANKS: #1 In TABLEMAU
Sunset | Aphmau Fanfiction| Being REWRITTEN by D3ADBITE
40 parts Complete
why are people still reading this it's so bad wkdjsjej - - - - Original first chapter published: 17 Aug 2016 Rewritten first chapter published: 23 Jan 2018 ©2016 alxxspxrks
da boys 🔥 & me || 𝐝𝐫𝐞𝐚𝐦𝐰𝐚𝐬𝐭𝐚𝐤𝐞𝐧 by hiimryn
23 parts Complete
| 𝐢'𝐦 𝐲𝐨𝐮𝐫 𝐞𝐝𝐢𝐭𝐨𝐫 𝐜𝐥𝐚𝐲, 𝐰𝐞 𝐬𝐡𝐨𝐮𝐥𝐝𝐧'𝐭 𝐛𝐞 𝐝𝐨𝐢𝐧𝐠 𝐭𝐡𝐢𝐬. | i will post my TW before every chapter, should not be that much. |has mature language|
You may also like
Slide 1 of 10
Besties 2 Couples cover
Dominant【Gene X Reader】[ Completed ] cover
He Loves Me【Zane X Reader】[ Completed ] cover
A New Experience (A Mystreet/Phoenix Drop High Fanfic) {Discontinued} cover
In This Together - Percabeth One Shots cover
MCD X Reader! Sad One Shots~ cover
What Will Become Of Us? [REMAKE] cover
RANTS GALORE AND RANDOM APHMAU STUFF ✓ - Book 1 cover
Sunset | Aphmau Fanfiction| Being REWRITTEN cover
da boys 🔥 & me || 𝐝𝐫𝐞𝐚𝐦𝐰𝐚𝐬𝐭𝐚𝐤𝐞𝐧 cover

Besties 2 Couples

32 parts Complete

It's been a week since High school began. You were a total loner that was before your bestie, Vylad Ro'Meave, appeared. You and Vylad have gotten closer ever since his transfer. You discovered answers. Answers that answers your questions when you were a child. However, you didn't expect to discover Vylad's feelings. •~•~•~• - Vulgar language - This is Book 1. Book 2 is Always Together - Characters, excluding OC and her family, belongs to Aphmau (YT) or @Empress_Aphmau (Wattpad) •~•~•~•

More details