Aphmau Memes 2
mars8131
  • Membaca 26,289
  • Suara 915
  • Bagian 92
  • Durasi <5 mins
  • Membaca 26,289
  • Suara 915
  • Bagian 92
  • Durasi <5 mins
mars8131
Lengkap, Awal publikasi Des 03, 2017
angelsvilleaphmaufalconclawuniversityfculoveloveparadisemcdmemememesminecraftdiariesmycraftmystreetpdhphoenixdrophighrandomstarlightwonderland
Another book of Aphmau memes. Could this be better than the first one? Probably not, BUT it could be. It has POTENTIAL.

   Status: 
     Completed
   Last Updated: 
      February 9, 2020

Please note that all memes in this book don't belong to me. They belong to their respective owners. Found all of them on Google Images and Pinterest.
Domain Publik
angelsvilleaphmaufalconclawuniversityfculoveloveparadisemcdmemememesminecraftdiariesmycraftmystreetpdhphoenixdrophighrandomstarlightwonderland
Daftar isi

92 bab

Daftar untuk menambahkan Aphmau Memes 2 ke perpustakaan Anda dan menerima pembaruan
atau
#11falconclawuniversity
Panduan Muatan
anda mungkin juga menyukai
Aarmau oleh AmunaLuna
36 Bagian Lengkap
This is my first story, so here goes nothing... This is a fanfic about what happens when Aphmau and Aaron fall in love! :3 WARNING! There will be conventional errors, and I am not the best of writers! Please don't judge! (Update: this is a book I wrote a long time ago and may have hints of cringe everywhere)
𝐛𝐚𝐤𝐮𝐛𝐨𝐭𝐭𝐨𝐦 𝐨𝐧𝐞𝐬𝐡𝐨𝐭𝐬 oleh crypticandy
42 Bagian Lengkap Dewasa
Bakubottom // Bakubowl oneshots ♡ [ warning ― slow updates. i have a horrible writing schedule, sorry ]
-It Do Be Like that Sometimes- |Laurance x reader| oleh Devil_Mirajane
65 Bagian Lengkap
You're one of Cadenzas guards, until some toe eyed cabbages show up claiming to be her friends. . "Laurance?!" I screamed, "What. The. Hell. What's this, the fourth time now?" I jumped up, and the room started to rock; we're back on the boat. Brilliant, I missed breakfast. ~random little bits~ Ik it's a shocking description but please just give the book a try :( Its based during Minecraft diaries, but don't try match timelines bc honestly it'll be painful to. The basic things are still there like they went to the Irene dimension n shit but everyone that didn't go, like Cadenza, Nicole and Dante are in their 20s rather than mid/late 30s - it's also not brung up in the series that much so its not a big concern 🤷‍♂️ It's a fanfic guys I wrote it for fun not to match with the whole timeline ~it's not the most innocent book but there aren't any lemons 😬 ~slow burn relationship ~chapters vary from 500 words to 1500 words lol I don't own shit for the book apart from the plot (even tho 50% of it is my inspiration from other stories and i mashed it all together lol) I also take full credit for the cover apart from the pic I found on Google lmao Started: 11 April 2020 Finished: 23 June 2020 Final chapter released (64): 18 August 2020
30 Day OTP [COMPLETED] oleh kayishere_
33 Bagian Lengkap
So yea. I'm doing this for 30 days! You can do it to! Go to MentallyLove's and there you go! My (One True Pair) is Laurmau <3! Also will create my own challenge for Laurmau fans also Garrmau!!!! ENJOYYY make sure to follow to follow up on details !Follow And Get Notifications To See When Your Favorite Books On My Account Are Updated And When My Conversation Wall Is Updated. Thank You And Enjoy The Book!
A New Experience (A Mystreet/Phoenix Drop High Fanfic) {Discontinued} oleh Meatballsparkle
18 Bagian Lengkap
Renee decides to move from her old neighborhood due a few more families moving there. She leaves all her friends from Kindergarden all the way to the 9th grade behind, but summer is almost over so Renee lives on Mystreet and goes to school at Phoenix Drop High!! Most Impressive Ranking: #738 on #vylad
Besties 2 Couples oleh Angel_MLoves
32 Bagian Lengkap
It's been a week since High school began. You were a total loner that was before your bestie, Vylad Ro'Meave, appeared. You and Vylad have gotten closer ever since his transfer. You discovered answers. Answers that answers your questions when you were a child. However, you didn't expect to discover Vylad's feelings. •~•~•~• - Vulgar language - This is Book 1. Book 2 is Always Together - Characters, excluding OC and her family, belongs to Aphmau (YT) or @Empress_Aphmau (Wattpad) •~•~•~•
MCD X Reader! Sad One Shots~ oleh TheFoodAddicts
30 Bagian Lengkap Dewasa
You've seen the good, the bad, so now, let's add some sadness. If you wanna cry, tear up, or see if you can man through these one shots like a boss, then read on. These one shots will contain some swearing, suicidal themes, etc. You've been warned. ****** HEYYY! Alyssa~Chan has been writing One shots for a while, so I decided I'd give it a go. But I'm going to add my own twist. Mine will be filled with morbid, sad, and down right depressing one shots of your favorite characters. Drop some ideas down below!
Everything Will Be Alright oleh SkytheShadowSword
27 Bagian Sedang dalam proses
Arriving at the lodge on Bunny Hill, Aaron immediately feels suspicious about the place. As him, Garroth, Lucinda and Kim scope out the cabin, Y/N, Aphmau and Zane find out new information about the lodge. Little do they all know, something lurks behind the walls of the lodge. An Aaron x reader x Gene. An Aphmau based x reader. [BOOK 3] BOOK 1: What Will Become Of Us? BOOK 2: All Good Things Come To An End [Ongoing] [Started: January 15, 2024] [Finished: ???]
Aphmau One Shots! | x Reader oleh Izzybella1807
34 Bagian Lengkap
[REQUESTS ARE STILL OPEN EVEN THOUGH THIS BOOK SAYS COMPLETED | If you are sending me a request, please tell me the plotline of the one shot. I will not be making anymore plots, I will just be writting the one shots.] One Shots from Mystreet, Mcd and more! Hope you enjoy!
What Will Become Of Us? [REMAKE] oleh SkytheShadowSword
31 Bagian Lengkap
A werewolf girl named Y/N transfers into Phoenix Drop High. What kind of friends will she make at this new school? What shenanigans will she find herself in? What sort of drama will unfold? [UPDATED] An Aaron x reader x Gene. An Aphmau based x reader. [BOOK 1] BOOK 2: All Good Things Come To An End BOOK 3: Everything Will Be Alright [COMPLETED] [Started: June 7, 2024] [Finished: January 28, 2025]
anda mungkin juga menyukai
Slide 1 of 10
Aarmau cover
𝐛𝐚𝐤𝐮𝐛𝐨𝐭𝐭𝐨𝐦 𝐨𝐧𝐞𝐬𝐡��𝐨𝐭𝐬 cover
-It Do Be Like that Sometimes- |Laurance x reader| cover
30 Day OTP [COMPLETED] cover
A New Experience (A Mystreet/Phoenix Drop High Fanfic) {Discontinued} cover
Besties 2 Couples cover
MCD X Reader! Sad One Shots~ cover
Everything Will Be Alright cover
Aphmau One Shots! | x Reader cover
What Will Become Of Us? [REMAKE] cover

Aarmau

36 Bagian Lengkap

This is my first story, so here goes nothing... This is a fanfic about what happens when Aphmau and Aaron fall in love! :3 WARNING! There will be conventional errors, and I am not the best of writers! Please don't judge! (Update: this is a book I wrote a long time ago and may have hints of cringe everywhere)

Detail lengkap