Story cover for Aphmau Memes 2 by mars8131
Aphmau Memes 2
mars8131
  • WpView
    Reads 26,543
  • WpVote
    Votes 915
  • WpPart
    Parts 92
  • WpHistory
    Time <5 mins
  • WpView
    Reads 26,543
  • WpVote
    Votes 915
  • WpPart
    Parts 92
  • WpHistory
    Time <5 mins
mars8131
Complete, First published Dec 03, 2017
angelsvilleaphmaufalconclawuniversityfculoveloveparadisemcdmemememesminecraftdiariesmycraftmystreetpdhphoenixdrophighrandomstarlightwonderland
Another book of Aphmau memes. Could this be better than the first one? Probably not, BUT it could be. It has POTENTIAL.

   Status: 
     Completed
   Last Updated: 
      February 9, 2020

Please note that all memes in this book don't belong to me. They belong to their respective owners. Found all of them on Google Images and Pinterest.
Public Domain
angelsvilleaphmaufalconclawuniversityfculoveloveparadisemcdmemememesminecraftdiariesmycraftmystreetpdhphoenixdrophighrandomstarlightwonderland
Table of contents

92 parts

Sign up to add Aphmau Memes 2 to your library and receive updates
or
#217pdh
Content Guidelines
You may also like
What Will Become Of Us? [REMAKE] by SkytheShadowSword
31 parts Complete
A werewolf girl named Y/N transfers into Phoenix Drop High. What kind of friends will she make at this new school? What shenanigans will she find herself in? What sort of drama will unfold? [UPDATED] An Aaron x reader x Gene. An Aphmau based x reader. [BOOK 1] BOOK 2: All Good Things Come To An End BOOK 3: Everything Will Be Alright [COMPLETED] [Started: June 7, 2024] [Finished: January 28, 2025]
"Regrets" a Garrmau FF •Under Extreme Editing• by Dat_AnimeFanatic
66 parts Complete
Disclaimer:I don't own MCD it belongs to Aphmau Cover is made by me. Ask permission before trying to use the cover. Please don't follow the story plot or I will report you. ................................................................... My name is Aphmau Beatrix Phoenix. I loved someone who loved me back, but still hurts me. I have someone who loves me and who comforts me whenever my lover hurts me. Love confuses me so much. I have a lot of Regrets. But I didn't expect this to be one of them. ------- This is my first book and it's so cringy it might give you unidentified diseases. So yes, if you're up for the challenge I won't stop you. ;3
Besties 2 Couples by Angel_MLoves
32 parts Complete
It's been a week since High school began. You were a total loner that was before your bestie, Vylad Ro'Meave, appeared. You and Vylad have gotten closer ever since his transfer. You discovered answers. Answers that answers your questions when you were a child. However, you didn't expect to discover Vylad's feelings. •~•~•~• - Vulgar language - This is Book 1. Book 2 is Always Together - Characters, excluding OC and her family, belongs to Aphmau (YT) or @Empress_Aphmau (Wattpad) •~•~•~•
30 Day OTP [COMPLETED] by kayishere_
33 parts Complete
So yea. I'm doing this for 30 days! You can do it to! Go to MentallyLove's and there you go! My (One True Pair) is Laurmau <3! Also will create my own challenge for Laurmau fans also Garrmau!!!! ENJOYYY make sure to follow to follow up on details !Follow And Get Notifications To See When Your Favorite Books On My Account Are Updated And When My Conversation Wall Is Updated. Thank You And Enjoy The Book!
𝐛𝐚𝐤𝐮𝐛𝐨𝐭𝐭𝐨𝐦 𝐨𝐧𝐞𝐬𝐡𝐨𝐭𝐬 by crypticandy
42 parts Complete Mature
Bakubottom // Bakubowl oneshots ♡ [ warning ― slow updates. i have a horrible writing schedule, sorry ]
𝐀𝐏𝐇𝐌𝐀𝐔 One Shots | x ʀᴇᴀᴅᴇʀ by Amybear1807
36 parts Complete
[REQUESTS ARE STILL OPEN EVEN THOUGH THIS BOOK SAYS COMPLETED | If you are sending me a request, please tell me the plotline of the one shot. I will not be making anymore plots, I will just be writting the one shots.] One Shots from Mystreet, Mcd and more! Hope you enjoy!
Little Dove (Gene x Reader) | Phoenix Drop High by Chloe3256
23 parts Complete Mature
"Come on Little Dove" Gene whined, "Teach me how to be good." After coming in contact with Phoenix Drop High's so called "bad boy", (Y/n) had no choice but to accept that he wouldn't leave them alone. Although (Y/n)'s original plan was to go through the rest of high school quietly, Gene was intrigued by the new student, determined to find a way to pry into their life. If only he knew what he got himself into. -- This book is made GENDER NEUTRAL so that everyone can read it :) -- just a WARNING for everyone, this book contains topics like suicide and depression. If you are not comfortable with these topics, I suggest not reading this book (update: I have decided to rate this book mature for this reason) 7/1/19 #1 in genexreader 4/22/20 #1 in gene 4/22/20 #1 in aphmau Takes place in Season 1 of PDH DISCLAIMERS: *I don't own the pictures I attach or use, they all belong to their rightful owners (for the cover, the watermark says Goldfish Ted, and the link went to Instagram but not their specific instagram (it took me to this weird website where I couldn't find the picture), so if you see this and it's your work, message me and I'll give you more credit.) ** (Y/N) belongs to you, not me ***Everything that I mention that is from Phoenix Drop High belongs to Aphmau, I do not own anything from it.
A New Experience (A Mystreet/Phoenix Drop High Fanfic) {Discontinued} by Meatballsparkle
18 parts Complete
Renee decides to move from her old neighborhood due a few more families moving there. She leaves all her friends from Kindergarden all the way to the 9th grade behind, but summer is almost over so Renee lives on Mystreet and goes to school at Phoenix Drop High!! Most Impressive Ranking: #738 on #vylad
This Summer -+Modern MCD+- by The_Purple_Pineapple
24 parts Complete
This is a modern version of minecraft diaries. It. Is. Not. MyStreet. Hopefully updated every day hopefully -+DISCLAIMER ALERT+- I do not own any of the following: -Characters -Music -Drawings (unless I say otherwise) If you are reading this. All of you. I love you. Not Even Kidding! Thank you so much! I love writing and just people reading my work, though their thoughts may be positive or negative... I love them!
Dominant【Gene X Reader】[ Completed ] by Mariko_Akiyama
32 parts Complete Mature
CONTENT CONTAINS : SEXUAL CONTENT DRUG USE VIOLENCE & STRONG LANGUAGE IF YOUR EASILY TRIGGERED OR UNCOMFORTABLE, DO NOT READ!! • " The nerve! " " What the hell did I just got myself into? " " How's my phone? " " 14 missed calls " " More pop tarts? " " Do you think it was a mistake? " " What is? " " The fact that I slept with him " " Well. . . .wait what?! " " I know! " " What?!, When?!, Where?!, Why?!, And how?! " • As the average savage adult that I am, I can be very serious with my work and words, but that happens exactly right after the death of my father, or so I thought. My brothers and I have been getting along very well, as a Bounty Hunter, I can be very intimidating, until I met him. His hair, his eyes, his touch is all I need, I never thought all that of him can make me feel like this and to my surprise, I act like a child. I was just no longer that average savage adult that I was, but everything changed when I learned about his past. I couldn't believe it nor could I even want to, it was overwhelming. I was lost, confused, it got to the point where I wasn't myself for a while. But the fun part is being Dominant. What's that supposed to mean?, What past did this person learn?, Is the father dead or alive?, Who's more dominant?, In what way? Read this book to know. Credit : To a game called 'PUBG' [ Completed ] Started : 1st January 2021 Finished : 24th March 2021 [ Highest Ranking : #6 in Aphmau ] [ #1 in Gene ] [ #1 in Gene x Reader ] Disclaimers : I do not own ANY of the characters only the ideas, they belong to a youtuber called Aphmau, I don't own any of the songs either or the pictures, except Y/n, it belongs to you. There are a few characters that I OWN. My OC : Xelora Kiselyov Catherine Fox Ash Lee Mandrell Natalie Rosetta Mandrell Coraline Alycia Jones Mariko Akiyama
You may also like
Slide 1 of 10
What Will Become Of Us? [REMAKE] cover
"Regrets" a Garrmau FF •Under Extreme Editing• cover
Besties 2 Couples cover
30 Day OTP [COMPLETED] cover
𝐛𝐚𝐤𝐮𝐛𝐨𝐭𝐭𝐨𝐦 𝐨𝐧𝐞𝐬𝐡𝐨𝐭𝐬 cover
𝐀𝐏𝐇𝐌𝐀𝐔 One Shots | x ʀᴇᴀᴅᴇʀ cover
Little Dove (Gene x Reader) | Phoenix Drop High cover
A New Experience (A Mystreet/Phoenix Drop High Fanfic) {Discontinued} cover
This Summer -+Modern MCD+- cover
Dominant【Gene X Reader】[ Completed ] cover

What Will Become Of Us? [REMAKE]

31 parts Complete

A werewolf girl named Y/N transfers into Phoenix Drop High. What kind of friends will she make at this new school? What shenanigans will she find herself in? What sort of drama will unfold? [UPDATED] An Aaron x reader x Gene. An Aphmau based x reader. [BOOK 1] BOOK 2: All Good Things Come To An End BOOK 3: Everything Will Be Alright [COMPLETED] [Started: June 7, 2024] [Finished: January 28, 2025]

More details