{MI MALA}
jayjayaly
  • Reads 3,412
  • Votes 117
  • Parts 10
  • Time 32m
  • Reads 3,412
  • Votes 117
  • Parts 10
  • Time 32m
jayjayaly
Ongoing, First published Dec 30, 2017
breakupcarlcarlgallaghercutkoskyethanethancutkoskyfionagallagherfuckupgallaghergallagherfamilygallavichjealousylillilxanlipgallagherlovelovelessmakeupnoelsantosohnooriginalcharactershamelesssofiacarsonxanör
Noel (NO-EL) knew she shouldn't have gotten hooked on that Gallagher boy, maybe if she had just steered herself away from him, everything would've been easier. Everything would've worked out for the best, she would've met someone sweet but she knew that wasn't what she wanted from the said boy. That's why it hurt even more when she had been thrown away by him, this time though..this time she would not fall back into him. If he wants her, he's going have to work for her.
Public Domain
breakupcarlcarlgallaghercutkoskyethanethancutkoskyfionagallagherfuckupgallaghergallagherfamilygallavichjealousylillilxanlipgallagherlovelovelessmakeupnoelsantosohnooriginalcharactershamelesssofiacarsonxanör
Table of contents

10 parts

Sign up to add {MI MALA} to your library and receive updates
or
#418makeup
Content Guidelines
You may also like
Saving Elliot ✓ by northbynorth
32 parts Complete
Elliot Jensen and Elliot Fintry have a lot in common. They share the same name, the same house, the same school, oh and they hate each other but, as they will quickly learn, there is a fine line between love and hate.
You may also like
Slide 1 of 1
Saving Elliot ✓ cover

Saving Elliot ✓

32 parts Complete

Elliot Jensen and Elliot Fintry have a lot in common. They share the same name, the same house, the same school, oh and they hate each other but, as they will quickly learn, there is a fine line between love and hate.

More details