Darklight Chronicles: Book Two - Revelation
Kadenn04
  • Reads 15
  • Votes 0
  • Parts 1
  • Time <5 mins
  • Reads 15
  • Votes 0
  • Parts 1
  • Time <5 mins
Kadenn04
Ongoing, First published Feb 04, 2018
chroniclesdarklightelvesfantasyfantasyadventurefantasycreaturesfantasyfictionhumansmodernfairytaleogresvampiresvampirewarwarcraftwarfare
The second part of the darklight chronicles trilogy.

War has officially broken out and a deadly threat has arisen to purge the land of all life resetting everything in the process. Will the vampires, elves, ogres and humans accept their fate or will they fight back?

Everything is on the line in the battle of Saeria and all its inhabitants...
Public Domain
chroniclesdarklightelvesfantasyfantasyadventurefantasycreaturesfantasyfictionhumansmodernfairytaleogresvampiresvampirewarwarcraftwarfare
Table of contents

1 part

Sign up to add Darklight Chronicles: Book Two - Revelation to your library and receive updates
or
#550fantasycreatures
Content Guidelines
You may also like
A Song of Gelato and Flambé by BksbyBkr
33 parts Complete
In the epic conclusion to the Devil's Deal series, Freya has one final chance to discover the full potential of her own power, and to use it to restore balance in the universe - once and for all. After the destruction caused by Roisin, Ferya and Torix come to terms with their losses and mistakes... And prepare for a final battle that will change everything.
You may also like
Slide 1 of 1
A Song of Gelato and Flambé cover

A Song of Gelato and Flambé

33 parts Complete

In the epic conclusion to the Devil's Deal series, Freya has one final chance to discover the full potential of her own power, and to use it to restore balance in the universe - once and for all. After the destruction caused by Roisin, Ferya and Torix come to terms with their losses and mistakes... And prepare for a final battle that will change everything.

More details