The Time Traveler
senpaiboops
  • Reads 3,051
  • Votes 100
  • Parts 6
  • Time 12m
  • Reads 3,051
  • Votes 100
  • Parts 6
  • Time 12m
senpaiboops
Complete, First published Mar 19, 2014
1939actionconstantinopleeraislamicempirejackjacktherippernewyorkworldfairpocketwatchrippertimetimetraveltravelvictorianvictorianeraworldwar2
What happens when an ordinary man finds a time machine? Or a time watch? Will he change the past? What will happen in the adventures of Jaden as he travels through time and space?
All Rights Reserved
1939actionconstantinopleeraislamicempirejackjacktherippernewyorkworldfairpocketwatchrippertimetimetraveltravelvictorianvictorianeraworldwar2
Table of contents

6 parts

Sign up to add The Time Traveler to your library and receive updates
or
#976travel
Content Guidelines
You may also like
Crown King: Return of The Labyrinth | ✓ by pillowsonfire
33 parts Complete
[SEQUEL TO GAME OF INSOMNIA] °°°The world of Eos has finally lived in peace for years after the war ended and the domain of Niflheim itself no longer existed. By the time he turns 25, Noctis gets crowned as King. No more threats, chaos and quarrels among civilians and with (Y/N) by his side, he was sure the peace in their lands would last till the end. Or. . . was it just what they thought? Moreover, a plague called Starscourge, starts to spread throughout Eos. And 'someone' from the past was not what they wanted to hear about.°°° STARTED | 04-28-18 ENDED | 06 - 14 - 20 June 14, 2020: #7 in Cloud
Batwomen: Vengeance | Quicksilver X OC by QueenZain3
27 parts Complete
"I Will Race To Your Heart" ____________________________________ Gotham City calls their hero known as The Batwoman a monster after an incident that happened, She was known to be more menacing, scary, violent, and unstoppable and that instills fear to criminals and even the innocence. The Avengers heard about the certain "monster" that flies around Gotham City, The Avengers go to the city to find Batwoman and find out that she isn't really a threat as people say she is. (Contains Mature Content)
Flames Of Love (Gene X Reader) by BobbyExists
48 parts Complete
"(Y/n), this is Gene. Gene this is the girl I've been telling you about." Ivy said. "Hi." I replied. "Hey." Gene said. AAAAAHHH!!! I'M GONNA FAINT!!! "So why exactly do you want me to meet him?" I asked. "Because. I don't want to spoil the surprise. Anyway, gotta run. See ya!" Ivy answered and left me. ○●○●○●○● So this is a Phoenix Drop High fanfic. And that's pretty much it. I hope you enjoy this. Book 1 of 3
Silent Magic (Wizards Tales of Arcadia) by Ari_yollo
16 parts Complete
Akira, the best friend of Douxie helps him through his adventures while stuck in the past. Her only problem is that she is mute. How can she help him, when she hasn't helped herself? *Disclaimer* I have been meaning to write this for a while and...Douxie is a gorgeous man sooo 0//-//0
SidNaaz Short Stories: Kahaniyaan Pyaar Ki by RiddhimaPaul
58 parts Ongoing
Another collection of Short Stories
Your Everything I have (book 2 of Not Alone Zane X Reader) by jess_sama
12 parts Complete
(Hey this is the second book of my Zane x reader so I hope you enjoy it. If you haven't read my first one please check it out) After arriving at Love~Love Paradise we all go our separate ways. What will happen on this beach resort? Will Zane and I become ever closer since we are married or will it all be the same? Figure it out in this story and I'll see you later.
The Cold Billionaire's Daughter by lynnmason586
66 parts Ongoing
A 5-year-old Valentina whose life gets turned upside down by the sudden passing of her beloved mother. Her only family or is it?. Lorenzo De luca is a cold, heartless billionaire who is known to never take shit from anyone. What happens when he finds out that he has a daughter?. Read to find out
Indian short stories by Narrativenest
71 parts Ongoing
Collection of different Indian short stories.
Bikers & Biscuits by thatspookybookworm
54 parts Complete
Novas dream has always been to open a bakery of her very own. Well now that she's moved to Galax, Georgia she is living that dream. She's got a lot of work to do on the shop before that happens though. One day as she's working she meets Eleanor, the niece of the president of the local MC. The Notorious Silencers. He's rugged and rough around the edges but once Madz meets Nova it's all over for him. It's love at first sight. But then the rival MC The Silver Serpents starts to cause problems. Will Novas bakery ever open? Will Madz be able to protect his club and new ol' lady? Let's find out! This will probably be smut free/closed door spice level. I don't know how to write spice yet. 🤫 This is my first story and you can definitely tell. The chapters aren't very long but I'll do my best to post both POV's. 🖤 I wrote this for fun and probably won't edit it much. In this you will find: • MC • Insta romance • He falls first • Found family • Age gap (20/35) • Protective MMC Thanks for giving my book a chance. 🥺 🛑 Warnings🛑 • Fighting • Foul language • Death • Kidnapping (Not by MMC) • Gun violence ✨Most Impressive Ranking✨ #1 Biker #1 Bakery #1 Foundfamily #1 Motorcycleclub #2 Finished Spotify playlist 🎧 https://open.spotify.com/playlist/6Jupng1WUUTWBtnvyb5mki?si=Q8yGTIbaSu2SbVd4hWBOOA&pi=IrxFHBljTiarU
No Going Back by AgaciaR
19 parts Ongoing
𝘙𝘢𝘯𝘥𝘰𝘮 𝘙𝘦𝘢𝘭𝘪𝘵𝘪𝘦𝘴 Book 3 Unforgivable Series #2 Where should your husband be when you're having a difficult, risky pregnancy? Right by your side! Where was he though? With his childhood best friend and business partner, partying, kissing and making out or worse. All marriages have ups and downs, but once you take a one-way route of cheating, there is No Going Back.
You may also like
Slide 1 of 10
Crown King: Return of The Labyrinth | ✓ cover
Batwomen: Vengeance | Quicksilver X OC cover
Flames Of Love (Gene X Reader) cover
Silent Magic (Wizards Tales of Arcadia) cover
SidNaaz Short Stories: Kahaniyaan Pyaar Ki cover
Your Everything I have (book 2 of Not Alone Zane X Reader) cover
The Cold Billionaire's Daughter cover
Indian short stories cover
Bikers & Biscuits cover
No Going Back cover

Crown King: Return of The Labyrinth | ✓

33 parts Complete

[SEQUEL TO GAME OF INSOMNIA] °°°The world of Eos has finally lived in peace for years after the war ended and the domain of Niflheim itself no longer existed. By the time he turns 25, Noctis gets crowned as King. No more threats, chaos and quarrels among civilians and with (Y/N) by his side, he was sure the peace in their lands would last till the end. Or. . . was it just what they thought? Moreover, a plague called Starscourge, starts to spread throughout Eos. And 'someone' from the past was not what they wanted to hear about.°°° STARTED | 04-28-18 ENDED | 06 - 14 - 20 June 14, 2020: #7 in Cloud

More details