Story cover for Random Oneshots by allymuddyorbs
Random Oneshots
allymuddyorbs
  • WpView
    MGA BUMASA 118
  • WpVote
    Mga Boto 6
  • WpPart
    Mga Parte 2
  • WpHistory
    Oras 21m
  • WpView
    MGA BUMASA 118
  • WpVote
    Mga Boto 6
  • WpPart
    Mga Parte 2
  • WpHistory
    Oras 21m
allymuddyorbs
Ongoing, Unang na-publish Apr 17, 2018
antisepticeyecordypatcrackficdarkiplierfamliforthelelzgtlivejacksepticeyemarkipliermatpatmuddyplieroriginalcharacters
A compilation of oneshots in the fan fiction world I've created. Each oneshot will come with a backstory to explain why they were made. Unless of course I had a PWP idea and I just wanted to write; in which case, I will also say it's a PWP.
All Rights Reserved
antisepticeyecordypatcrackficdarkiplierfamliforthelelzgtlivejacksepticeyemarkipliermatpatmuddyplieroriginalcharacters
Table of contents

2 parte

Sign up to add Random Oneshots to your library and receive updates
o
#131matpat
Mga Alituntunin ng Nilalaman
Magugustuhan mo rin ang
Crimson (Googleiplier × Reader) ni Larkwing213
27 parte Kumpleto
~Completed~ Uh, so I'm not good a descriptions but I'll try and hopefully not spoil anything. Yeah, no. I tried. I couldn't do it. Sorry XD.
Markiplier & Jacksepticeye One-Shots ni Alanornala
17 parte Ongoing Mature
Little bit of Mark, Little bit of Jack and a whole lotta Fan-fiction. :) 🎮 PLEASE READ MY JACK IMAGINES AND MARK IMAGINES BEFORE HERE, THIS IS ONLY A BACKUP🎮🙂
The Egos and you ni BlueBatss
45 parte Kumpleto
When I wrote this I wrote it as reader is AFAB, however I'd be happy to try make one for those AMAB/Gneutral if anyone was interested. Maybe even add more of the newer egos 👀 Preference book of Markiplier and Jacksepticeye's alter egos. Or just what I think they will be like under the given circumstance Includes: Darkiplier Wilford Warfstache Googleplier Host Antisepticeye Henrik Chase Jameson Jackson
Tommyinnit + Tubbo oneshots (NO SHIPPING!) ni AweSam_D0g
47 parte Kumpleto
these are experimental oneshots! I'm trying to find my way of writing and I got inspired by another one shot book to write these. there will be NO shipping at all, the shipping of minors is disgusting, please don't do it! there will be angst and stuff though, but I'll give warnings! again, THIS IS EXPERIMENTAL WRITING!! so please don't expect it to be good (:
Markiplier and Jacksepticeye Imagines ni starlitcyndal
104 mga parte Kumpleto Mature
{M} for Markiplier {J} for Jacksepticeye I'm just a girl and I like writing stories about two of my favorite YouTubers. Who knew they'd be actual one-shots instead of imagines.
Collection ni Sireb_TStrei
6 mga parte Kumpleto
A collection of short stories and oneshots, both Fanfiction and originals. I hope you enjoy!
Lonely lovers (Antisepticeye x Reader) ni Sean_Graham
21 parte Kumpleto Mature
She was always alone.... she never had friends she barely knew what it was like to love someone.... she was perfect.... but so broken.... lost.... À̴̱͝L̜̳ͮ̉O̴̰̝̞̽̄͊͟ͅÑ͖̖̲̐̒͗E̷͔̎͠͠͝ͅ she never deserved to be neglected, and yet she was. Before her all i wanted was the control over what was rightfully mine... now its more complicated, i want my own... my own body so i can forever hold her... and cherish her.... but our kinds aren't meant to be... we could be killed if anyone found out. The risks could be taken if the love is worth waitin. She is perfect... and i want her all to myself.... and it angers me every time i see them with her, they dont belong with her, i do.... and i will prove that too her.... or I'll just force her to see my way... (This is an Anti x Reader, yes this is why i gave up on my other one... but don't expect me not to give up on this one lol anyways enjoy! Warning there is explicit content in this, sexual content, murder, suicide, cursing, racism, and other triggering topics will be mentioned in this story so please read on your own terms <3 love y'all)
*BEING REWRITTEN* My Savior (Adopted by Markiplier) ni seashelbz
57 parte Kumpleto Mature
*REWRITTEN* The new book is "Finding myself again" and it is up on my profile! Warning this story contains: Swearing, mentions of cutting, and other trigger warnings if you do not feel comfortable with this stuff, do not read.
Savior ni IceQueen713
18 parte Kumpleto Mature
: Book 1 : :TRIGGER WARNING:PLEASE READ: trigger warning I will not give any further warning it ruins the atmosphere this story will have topics for a mature audience such as possible lemon rape death slight Gore cursing and is recommended for 18+ or you may read at your own risk. Disclaimer: I Don't own Markiplier/Darkiplier Jacksepticeye/Antisepticeye and NONE of the Artwork or Photo's are Mine they are off of a Public Domain such as Twitter/Facebook. Thank You ♡
Magugustuhan mo rin ang
Slide 1 of 9
Crimson (Googleiplier × Reader) cover
Markiplier & Jacksepticeye One-Shots cover
The Egos and you cover
Tommyinnit + Tubbo oneshots (NO SHIPPING!) cover
Markiplier and Jacksepticeye Imagines cover
Collection cover
Lonely lovers (Antisepticeye x Reader) cover
*BEING REWRITTEN* My Savior (Adopted by Markiplier) cover
Savior cover

Crimson (Googleiplier × Reader)

27 parte Kumpleto

~Completed~ Uh, so I'm not good a descriptions but I'll try and hopefully not spoil anything. Yeah, no. I tried. I couldn't do it. Sorry XD.

Karagdagang detalye