Story cover for Night Wolves by King_Cam_
Night Wolves
King_Cam_
  • WpView
    Reads 110,678
  • WpVote
    Votes 3,714
  • WpPart
    Parts 44
  • WpHistory
    Time 2h 53m
  • WpView
    Reads 110,678
  • WpVote
    Votes 3,714
  • WpPart
    Parts 44
  • WpHistory
    Time 2h 53m
King_Cam_
Complete, First published Apr 18, 2018
Mature
adventurebxbxbeditingfoxshiftersgaygoodlgbtmysterypolyamoryromanceschooltransgendervampireswattpadwattys2019werewolfwolves
The Moon Goddess has always been a mysterious woman, but this time. Something definitely went wrong. 

Phoenix, a young man, who thought his mother had died was newly mated to two werewolves. 
Quite a shock to him considering that his father is a wolf hunter. 

Zander and Luka grew up together with their homophobic father who gave them a tough time. When they find out that their mate is the same person, they are quite surprised but nothing new. 

Everything was a mystery in the small town, new secrets unfolded daily. 

Stay tuned to find out.
Public Domain
adventurebxbxbeditingfoxshiftersgaygoodlgbtmysterypolyamoryromanceschooltransgendervampireswattpadwattys2019werewolfwolves
Table of contents

44 parts

Sign up to add Night Wolves to your library and receive updates
or
Content Guidelines
You may also like
The Wolf Within (Book 1 of Wolf Within Series) by HouseofDL
33 parts Complete
**Book 2 Is now out! Title: The Wolf Without! Check out our profile to find it!** This story is told in two perspectives; Dakota was a normal woman working her way through life; but when she goes on vacation and tries to relax in her family's cabin near the woods, something happens. One fated night forces her down a road on which she not only meets the most beautiful woman ever; she also becomes painfully aware of the large part of herself she's been missing all her life: who, or rather what, she really is. A werewolf (with a pet cat). Accalia (a.k.a. Lia), Alpha of the Protettori Della Luna, is the head trainer for all guardians, warriors and hunters belonging to the United Pack Territories. She had spent several years searching in vein for her mate. Thankfully, the seventh time is the charm and she found her. However, the Moon Goddess may have other plans.
Vulcan Wolf (Lesbian Story) by MitchezHunter
22 parts Complete Mature
Moving to a new place,Knight finds out that she's not the normal human kid she always thought she was. Turns out she's a werewolf and not just any werewolf she's a Vulcan too. There's a traitor among them, someone no one suspected,will they find out who it is and save their families or will they be too late? ★¢★ I felt a weird sensation crawling through my veins,my breathing got heavy, my heart pounded,I felt scared but not for myself,something is not right!
Second Chances (mxm, poly, mpreg) by ladydragyn
67 parts Complete Mature
Follow several werewolf rejectees on their journey to acceptance and adaptation to the new world the moon goddess is setting them up for. There are multiple couplings and intersecting stories. This story is mature meaning for 18+. There will be no warnings other than what's in tags. You're adults you should be able to handle it.
His Moon Luna by Oluwatoyosidare
44 parts Complete Mature
SYNOPSIS He's the ice to her fire She's the storm to his calm He's the light to her Life She's the moon to his earth Being born a half werewolf was not what she wanted; she became an outcast, a punching bag to her pack, she didn't even have a mate, that is until she leaves for college. Now back four years later, with a kick ass attitude and a huge secret; she must learn to adapt to the changes around her especially when she finds Him. He is the king to all werewolves; filled with strength and authority, he must keep the calm to the terror that is about to be unleashed especially when he finally finds Her. How can they both stop the past from repeating itself and still find the time to love themselves especially when they find out her huge secret.
Her Lost Light (destined prequel) by Little_Freesia
15 parts Complete
"Love can make us more stronger and braver, but at the same time love can make us weak" The second daughter of the moon queen met the one who she will love the most, she already planned for their future together, a family on their own, growing old together, a bright and lovely future ahead for them. But fate hinders their suppose to be happy ending, she who's just the shadow of her older twin sister was chosen to be the next moon goddess that's guides and protect the werewolves. Being the moon goddess, is a hefty responsibility, according to the golden rule, when someone was chosen to be the goddess, she can't marry and had her own family , because the whole world needs her. What will she do? Can she renounce her own destiny for the one that she truly loves? Or destiny itself will find a way to seperate the two?.
Alpha's Obsession by CatKingswoman
25 parts Complete Mature
Ella. Simple life right? Wrong. She was attacked by a werewolf when she was younger and has been forbidden to enter the forest again. But what she discovers when she enters the forest will change her life forever. Her brother and father are hunters, but they hunt the very things that are her future. What will Ella discover about her family and how is she going to deal with it? Will she fight alongside the man she is destined for? Or will she fight alongside her family?
A Forbidden Love by AdventureWriter17
12 parts Complete
Angela Harris is just a simple human girl. According to any other human. But, there is something different about her. Her father is a hunter, who also abuses her. A werewolf hunter. And, she's mates with the future Alpha of the Silver Star Pack! Oliver Steven's father has always had a hatred for humans, especially hunters. So when he finds out his son is mated with a human girl who is the daughter of a hunter, he is furious. He demands Oliver to reject her and find a pretty, young, wolf girl. Will Oliver obey his father and reject his mate? What problems will arise for the young couple? Will they get through them? Will Oliver become Alpha and have his mate as his Luna by his side? Find out the answer to these questions in A Forbidden Love!
The Crimson Pack by Somethingoranotherb
25 parts Complete Mature
Dana is a normal girl, well that was until 6 days ago, then she started hearing a voice in her head and woke up butt-naked next to her apartment. Imagine her surprise when she finds out she's been sheltered from a VERY important secret her whole life; she has some extra mutations in her DNA, that allows her to shift into a wolf. No biggie, she only had a mental breakdown thinking she was going crazy. Now she's thrown into a prophecy that makes it so she has four mates. Ahem, yes, Moon Goddess, I'd like a word-. How's she gonna navigate all this? Well, come along for the ride and you'll see. *Contains dubious consent*
The Rise of the Lycans by MGKimmy06
49 parts Complete
Laura is different. She knew this when she was six after realising she was adopted. Now she is seventeen, waiting to shift into her wolf and find her mate. But before she could journey to find her wolf and her mate, she had to go to a ball in the Moon Royal Palace for the coronation of the new Alpha King. She is the adopted daughter of a Beta. While there, she found her wolf voice but not her wolf form. Also, her mate, Nathan Crescent. The new Alpha King. The night, however, turned into a nightmare when they learnt that lycans still existed. They called themselves Lycan Brothers. A prophecy from the moon goddess herself made them come out of hiding. They were searching for the marked one. PLEASE NOTE - THIS STORY HAS GRAMMATICAL, SPELLING, AND STORY PROGRESSION ERRORS.
the opposition & the red moon by xwinter_leox
21 parts Complete Mature
The Book Summary In a world where darkness and desire collide, secrets and supernatural forces entwine to shape the destinies of those who dare to defy their own natures. Kaelen, a fierce Lupus werewolf, and Solarius, an enigmatic Arcturus Vampire, were once bound by animosity. Their worlds, separated by blood and tradition, clashed in a whirlwind of conflict and longing. But love knows no boundaries, and as they navigated a treacherous path toward acceptance, they discovered that unity could conquer even the deepest divides. Seraphina, a powerful witch and vampire, and Nyota, a Lupus with a fierce spirit, found solace and love in each other's arms, defying the expectations of their supernatural kind. Together, they faced ancient cults, the mysteries of their own identities, and the challenges of a world that refused to accept their unconventional love. Amidst the chaos, a little girl named Luna emerged-a harbinger of secrets from a forgotten past. In a tale of passion, conflict, and sacrifice, their journey unfolds under the watchful gaze of the blood moon, where love and loss converge in a climactic twist that will leave your heart pounding and your soul forever haunted. This is a story of love that transcends boundaries and a destiny entwined with darkness. The question remains: Can love truly conquer all, or will the forces of fate prove insurmountable? ~Blood Moon's Embrace~ invites you to lose yourself in a world of forbidden desires, intricate mysteries, and the enduring power of love.
You may also like
Slide 1 of 10
The Wolf Within (Book 1 of Wolf Within Series) cover
Vulcan Wolf (Lesbian Story) cover
Second Chances (mxm, poly, mpreg) cover
His Moon Luna cover
Her Lost Light (destined prequel) cover
Alpha's Obsession cover
A Forbidden Love cover
The Crimson Pack cover
The Rise of the Lycans cover
the opposition & the red moon cover

The Wolf Within (Book 1 of Wolf Within Series)

33 parts Complete

**Book 2 Is now out! Title: The Wolf Without! Check out our profile to find it!** This story is told in two perspectives; Dakota was a normal woman working her way through life; but when she goes on vacation and tries to relax in her family's cabin near the woods, something happens. One fated night forces her down a road on which she not only meets the most beautiful woman ever; she also becomes painfully aware of the large part of herself she's been missing all her life: who, or rather what, she really is. A werewolf (with a pet cat). Accalia (a.k.a. Lia), Alpha of the Protettori Della Luna, is the head trainer for all guardians, warriors and hunters belonging to the United Pack Territories. She had spent several years searching in vein for her mate. Thankfully, the seventh time is the charm and she found her. However, the Moon Goddess may have other plans.

More details