Story cover for Night Wolves by King_Cam_
Night Wolves
King_Cam_
  • WpView
    Reads 110,678
  • WpVote
    Votes 3,714
  • WpPart
    Parts 44
  • WpHistory
    Time 2h 53m
  • WpView
    Reads 110,678
  • WpVote
    Votes 3,714
  • WpPart
    Parts 44
  • WpHistory
    Time 2h 53m
King_Cam_
Complete, First published Apr 18, 2018
Mature
adventurebxbxbeditingfoxshiftersgaygoodlgbtmysterypolyamoryromanceschooltransgendervampireswattpadwattys2019werewolfwolves
The Moon Goddess has always been a mysterious woman, but this time. Something definitely went wrong. 

Phoenix, a young man, who thought his mother had died was newly mated to two werewolves. 
Quite a shock to him considering that his father is a wolf hunter. 

Zander and Luka grew up together with their homophobic father who gave them a tough time. When they find out that their mate is the same person, they are quite surprised but nothing new. 

Everything was a mystery in the small town, new secrets unfolded daily. 

Stay tuned to find out.
Public Domain
adventurebxbxbeditingfoxshiftersgaygoodlgbtmysterypolyamoryromanceschooltransgendervampireswattpadwattys2019werewolfwolves
Table of contents

44 parts

Sign up to add Night Wolves to your library and receive updates
or
Content Guidelines
You may also like
Black as Coal | ✓ by HalstonCarter-Rose
75 parts Complete Mature
Cronan is angry. Angry that after years of waiting, he's mated to the one wolf he never wanted. Fen is stuck. Stuck in a state of purgatory that he doesn't know how to escape from. After learning of his mate's crimes, Cronan never expected to see him again. However, fate works in mysterious ways and the Moon Goddess isn't ready to allow the pair to walk away from each other. The logical side of Cronan tells him to walk away before he gets entangled in Fen's web of deceit, but he can't deny the way the bond they share calls for him - nor can he deny the feeling of Fen's lips on his time and time again.
The Rise of the Lycans by MGKimmy06
49 parts Complete
Laura is different. She knew this when she was six after realising she was adopted. Now she is seventeen, waiting to shift into her wolf and find her mate. But before she could journey to find her wolf and her mate, she had to go to a ball in the Moon Royal Palace for the coronation of the new Alpha King. She is the adopted daughter of a Beta. While there, she found her wolf voice but not her wolf form. Also, her mate, Nathan Crescent. The new Alpha King. The night, however, turned into a nightmare when they learnt that lycans still existed. They called themselves Lycan Brothers. A prophecy from the moon goddess herself made them come out of hiding. They were searching for the marked one. PLEASE NOTE - THIS STORY HAS GRAMMATICAL, SPELLING, AND STORY PROGRESSION ERRORS.
His Hunter by monochromemonotone
28 parts Complete Mature
They both have their secrets. Some worse than others, but all of them dark and thorny. Maybe the only thing that can save them from themselves...is each other. Cole had always been fascinated by the idea of having a mate. It seemed like such an easy thing. At least, that's what he thought. But that was before. Before he realized that he--a full blooded human--had a mate himself. And then, instead of easy...it seemed impossible. 1: Because his dad doesn't approve of humans mating wolves, despite Cole's sister. And 2: Cole's mate is...a man. God knows what his dad would think of that. But despite his father, despite the fact that he's a Hunter and Lionel is a wolf... Cole has a lot of things he doesn't tell people. How his mother is dead. How his sister is a Luna. How much he looks up to his dad even if the man doesn't deserve it. And now, how much he liked the feeling of Lionel's lips. But he would never tell anyone that. Especially Lionel. And wow, how that drives Lionel crazy. {His Moon spinoff, story retold}
The Unusual Mate by KaylaLynnBlalock
11 parts Complete
Blay Lynn was visiting her Mom's grave when Basil caught her scent. Now with moving in with the Moon Goddess and her son, while pulling her best friends in with her. Skylar Windchester, Athena Macho, Carmen and Rose Milo are Blays best friend, they are more like sisters, they call themself The Lone Wolves. Blays father is Jone Lynn he was the first Omega, the one who enforces punishment and death on the one who is guilty. He left the Royal pack and first shifted to be with his mate, Lisa Lynn, at that time the war between human and wolves had ended, and Basil still had a burning hatred for humans, Lisa was human. When Lisa was killed by a rogue it killed Blays wolf and turned it into anger. Now what will happen when Basil is hit with The Lone Wolves crazy?
Alpha's Obsession by CatKingswoman
25 parts Complete Mature
Ella. Simple life right? Wrong. She was attacked by a werewolf when she was younger and has been forbidden to enter the forest again. But what she discovers when she enters the forest will change her life forever. Her brother and father are hunters, but they hunt the very things that are her future. What will Ella discover about her family and how is she going to deal with it? Will she fight alongside the man she is destined for? Or will she fight alongside her family?
Vulcan Wolf (Lesbian Story) by MitchezHunter
22 parts Complete Mature
Moving to a new place,Knight finds out that she's not the normal human kid she always thought she was. Turns out she's a werewolf and not just any werewolf she's a Vulcan too. There's a traitor among them, someone no one suspected,will they find out who it is and save their families or will they be too late? ★¢★ I felt a weird sensation crawling through my veins,my breathing got heavy, my heart pounded,I felt scared but not for myself,something is not right!
The Crimson Pack by Somethingoranotherb
25 parts Complete Mature
Dana is a normal girl, well that was until 6 days ago, then she started hearing a voice in her head and woke up butt-naked next to her apartment. Imagine her surprise when she finds out she's been sheltered from a VERY important secret her whole life; she has some extra mutations in her DNA, that allows her to shift into a wolf. No biggie, she only had a mental breakdown thinking she was going crazy. Now she's thrown into a prophecy that makes it so she has four mates. Ahem, yes, Moon Goddess, I'd like a word-. How's she gonna navigate all this? Well, come along for the ride and you'll see. *Contains dubious consent*
A Forbidden Love by AdventureWriter17
12 parts Complete
Angela Harris is just a simple human girl. According to any other human. But, there is something different about her. Her father is a hunter, who also abuses her. A werewolf hunter. And, she's mates with the future Alpha of the Silver Star Pack! Oliver Steven's father has always had a hatred for humans, especially hunters. So when he finds out his son is mated with a human girl who is the daughter of a hunter, he is furious. He demands Oliver to reject her and find a pretty, young, wolf girl. Will Oliver obey his father and reject his mate? What problems will arise for the young couple? Will they get through them? Will Oliver become Alpha and have his mate as his Luna by his side? Find out the answer to these questions in A Forbidden Love!
The Wolf Within (Book 1 of Wolf Within Series) by HouseofDL
33 parts Complete
**Book 2 Is now out! Title: The Wolf Without! Check out our profile to find it!** This story is told in two perspectives; Dakota was a normal woman working her way through life; but when she goes on vacation and tries to relax in her family's cabin near the woods, something happens. One fated night forces her down a road on which she not only meets the most beautiful woman ever; she also becomes painfully aware of the large part of herself she's been missing all her life: who, or rather what, she really is. A werewolf (with a pet cat). Accalia (a.k.a. Lia), Alpha of the Protettori Della Luna, is the head trainer for all guardians, warriors and hunters belonging to the United Pack Territories. She had spent several years searching in vein for her mate. Thankfully, the seventh time is the charm and she found her. However, the Moon Goddess may have other plans.
You may also like
Slide 1 of 9
Black as Coal | ✓ cover
The Rise of the Lycans cover
His Hunter cover
The Unusual Mate cover
Alpha's Obsession cover
Vulcan Wolf (Lesbian Story) cover
The Crimson Pack cover
A Forbidden Love cover
The Wolf Within (Book 1 of Wolf Within Series) cover

Black as Coal | ✓

75 parts Complete Mature

Cronan is angry. Angry that after years of waiting, he's mated to the one wolf he never wanted. Fen is stuck. Stuck in a state of purgatory that he doesn't know how to escape from. After learning of his mate's crimes, Cronan never expected to see him again. However, fate works in mysterious ways and the Moon Goddess isn't ready to allow the pair to walk away from each other. The logical side of Cronan tells him to walk away before he gets entangled in Fen's web of deceit, but he can't deny the way the bond they share calls for him - nor can he deny the feeling of Fen's lips on his time and time again.

More details