Night Wolves
King_Cam_
  • Reads 110,056
  • Votes 3,713
  • Parts 44
  • Time 2h 53m
  • Reads 110,056
  • Votes 3,713
  • Parts 44
  • Time 2h 53m
King_Cam_
Complete, First published Apr 18, 2018
Mature
adventurebxbxbeditingfoxshiftersgaygoodlgbtmysterypolyamoryromanceschooltransgendervampireswattpadwattys2019werewolfwolves
The Moon Goddess has always been a mysterious woman, but this time. Something definitely went wrong. 

Phoenix, a young man, who thought his mother had died was newly mated to two werewolves. 
Quite a shock to him considering that his father is a wolf hunter. 

Zander and Luka grew up together with their homophobic father who gave them a tough time. When they find out that their mate is the same person, they are quite surprised but nothing new. 

Everything was a mystery in the small town, new secrets unfolded daily. 

Stay tuned to find out.
Public Domain
adventurebxbxbeditingfoxshiftersgaygoodlgbtmysterypolyamoryromanceschooltransgendervampireswattpadwattys2019werewolfwolves
Table of contents

44 parts

Sign up to add Night Wolves to your library and receive updates
or
Content Guidelines
You may also like
Moon Goddess by Lena_Castle
22 parts Ongoing Mature
When paths between Heaven and Hell cross. -.-.-.-.-.-.-.-.-.-.- A series of events leaves her dying on the side of the road. Until a mystery man comes to her rescue and forces her into a life she had no idea existed. Can she navigate this strange existence or could this be the last straw which consumes her humanity? ---- A/N On hold. Enjoy! And thank you for reading. 😊 ----
His Hunter by monochromemonotone
28 parts Complete Mature
They both have their secrets. Some worse than others, but all of them dark and thorny. Maybe the only thing that can save them from themselves...is each other. Cole had always been fascinated by the idea of having a mate. It seemed like such an easy thing. At least, that's what he thought. But that was before. Before he realized that he--a full blooded human--had a mate himself. And then, instead of easy...it seemed impossible. 1: Because his dad doesn't approve of humans mating wolves, despite Cole's sister. And 2: Cole's mate is...a man. God knows what his dad would think of that. But despite his father, despite the fact that he's a Hunter and Lionel is a wolf... Cole has a lot of things he doesn't tell people. How his mother is dead. How his sister is a Luna. How much he looks up to his dad even if the man doesn't deserve it. And now, how much he liked the feeling of Lionel's lips. But he would never tell anyone that. Especially Lionel. And wow, how that drives Lionel crazy. {His Moon spinoff, story retold}
Bringing her back! by Jamesmcrthr
15 parts Complete
Tara rejected her mate after her mate had the dream about her. Tara was scared because Konnie was her student. Konnie disappears and no one knows anything and being the only child of the Alpha family things dont look good for the future of the pack but what will the do when she suddenly reappears?
The Crimson Pack by Somethingoranotherb
25 parts Complete Mature
Dana is a normal girl, well that was until 6 days ago, then she started hearing a voice in her head and woke up butt-naked next to her apartment. Imagine her surprise when she finds out she's been sheltered from a VERY important secret her whole life; she has some extra mutations in her DNA, that allows her to shift into a wolf. No biggie, she only had a mental breakdown thinking she was going crazy. Now she's thrown into a prophecy that makes it so she has four mates. Ahem, yes, Moon Goddess, I'd like a word-. How's she gonna navigate all this? Well, come along for the ride and you'll see. *Contains dubious consent*
𝗟𝗼𝘀𝘁 𝗜𝗻 𝗖𝗵𝗮𝗼𝘀 ✔ 𝗚𝘅𝗚𝘅𝗚 by plxnet-earth
34 parts Complete Mature
❝𝐘𝐨𝐮'𝐫𝐞 𝐨𝐮𝐫𝐬, 𝐡𝐞𝐚𝐫𝐭, 𝐦𝐢𝐧𝐝 𝐚𝐦𝐝 𝐬𝐨𝐮𝐥, 𝐚𝐧𝐝 𝐧𝐨𝐭𝐡𝐢𝐧𝐠 𝐜𝐚𝐧 𝐜𝐡𝐚𝐧𝐠𝐞 𝐭𝐡𝐚𝐭.❞ they were feared. she was bullied. they were powerful. she was weak. they had people bowing. she had people laughing. alphas. omega. wolves. human. two different worlds collide unexpectedly in the night under the full moon. ❝𝐈 𝐚𝐦 𝐲𝐨𝐮𝐫𝐬.❞
A Half Truth by Moonwriting1987
44 parts Ongoing Mature
"Everyone owns a dark side, hidden from the world" Moon Goddess Moon Goddess is known as the kindest deity and the protector of wolves. She imbued wolves with her soul and power. She adores all wolves, regardless of their rank. She gave every wolf in the world a mate. Mates are a wolf's destiny. The Moon Goddess blessed each wolf with a mate because a mate held a piece of their soul. A mate keeps a wolf calm and composed. Only a mate can control the beast of a werewolf. Without a mate, a wolf can lose his sanity and transform into the human form of a werewolf. But what if a wolf decides to oppose her? He rejects his mate and falls in love with a forbidden clan woman, with whom he mates. This is an insult to her. However, she did not punish them because she knew fate would punish them severely. True to her words, the wolf's chosen mate dies while giving birth to two stunning twin sisters. One of them was taken by the woman's clan. However, the wolf is successful in saving the elder one, "Olivia Hart". Instead of punishing the wolf and his mate, Moon Goddess chose to punish their innocent daughters. She decided to punish them in the most interesting way. She sees opportunity in them. An opportunity to fulfill an old promise while also granting her wishes. It is like killing three birds with one stone. Nonetheless, her selfish actions ruined some lives... ..................
Midnight Sun by RedRumRoyalty_
70 parts Complete Mature
(Sequel to I Am Alpha Lizzy?) Elizabeth is older now and now she is looking for her mate. Her moms don't care who they are as long as they take care of their baby girl. Isabella just turned 18 and she has been abused by her father since she was 9. She turned into her wolf by herself. How will Isabella react when she is connected to Selene, the moon goddess? What will happen when they meet?
Alpha descent: A Human's rise to power (BxB) by Kyrielle_woods_027
20 parts Ongoing Mature
(BxB) Wolf's blood, human body & Alpha soul. A Maelstrom merge that was left to be dealt by one person alone. Alexander Wolf, the born-human descendant of the greatest pack of his world, is the sole heir of the Alpha of the prestigious Prime Crescent Pack. His birth has always been a calamity, a distress. Every breath he takes reminds him of the misfortune he's caused to his parents, family, and pack. Although welcomed, he doubts their sincerity, as he lacks a wolf and the ability to shift like other werewolves. He's spent his life alone, hiding behind high walls and large doors whenever his parents tried to introduce him to the pack. But now, with his coming of age, he must step forward into alpha duties and serve his pack. Will he find himself ruling with grace, or will he run away like he always has? Will he give up his birthright due to the Moon Goddess's cruel twist of fate? As a human in a wolf pack, his life is far from fortunate, unlike his human mother, the Luna, who is protected by the powerful Alpha, his father. However, he can't escape the whispers within the pack: "Can a human really be our next Alpha? No way!" His life is already a mess, and the Awakening Ceremony, a significant milestone, has shaken him to his core. He doubts his ability to fulfill alpha duties and find a mate bond, especially without a wolf of his own. Will he find someone to accept him without being looked down upon? Can he satisfy his primal urges without being a werewolf himself? But he doubts whether he'll have a mate at all. Cover by @CuteFairyDust Started: 28/06/2024
The Rise of the Lycans by MGKimmy06
49 parts Complete
Laura is different. She knew this when she was six after realising she was adopted. Now she is seventeen, waiting to shift into her wolf and find her mate. But before she could journey to find her wolf and her mate, she had to go to a ball in the Moon Royal Palace for the coronation of the new Alpha King. She is the adopted daughter of a Beta. While there, she found her wolf voice but not her wolf form. Also, her mate, Nathan Crescent. The new Alpha King. The night, however, turned into a nightmare when they learnt that lycans still existed. They called themselves Lycan Brothers. A prophecy from the moon goddess herself made them come out of hiding. They were searching for the marked one. PLEASE NOTE - THIS STORY HAS GRAMMATICAL, SPELLING, AND STORY PROGRESSION ERRORS.
Miakoda by AbbyAM101
43 parts Ongoing
A war that ripped apart and left the supernaturals segregated and lost... Abandoned by the Moon Goddess? A special shifter, battered and torn... Will the rest of the supernaturals accept her? Will they teach her what love is? Will they protect her from the next war coming.... Or will she protect them?
You may also like
Slide 1 of 10
Moon Goddess cover
His Hunter cover
Bringing her back! cover
The Crimson Pack cover
𝗟𝗼𝘀𝘁 𝗜𝗻 𝗖𝗵𝗮𝗼𝘀 ✔ 𝗚𝘅𝗚𝘅𝗚 cover
A Half Truth cover
Midnight Sun cover
Alpha descent: A Human's rise to power (BxB) cover
The Rise of the Lycans cover
Miakoda cover

Moon Goddess

22 parts Ongoing Mature

When paths between Heaven and Hell cross. -.-.-.-.-.-.-.-.-.-.- A series of events leaves her dying on the side of the road. Until a mystery man comes to her rescue and forces her into a life she had no idea existed. Can she navigate this strange existence or could this be the last straw which consumes her humanity? ---- A/N On hold. Enjoy! And thank you for reading. 😊 ----

More details