The Fallen Legion: The feeling of sorrow
Onlinemaster05
  • Reads 38,940
  • Votes 424
  • Parts 11
  • Time 50m
  • Reads 38,940
  • Votes 424
  • Parts 11
  • Time 50m
Onlinemaster05
Complete, First published Apr 23, 2018
fanfictionfinishedforhonormalereadermalewardenmercypeacekeeperreaderreaderxcharacter
This is the story of the Warden (Y/N) (L/N), who now is a part of the Blackstone Legion, but also starting to question their leader Apollyon.

This is the first part of what is likely o become a trilogy called „The fallen Legion".
All Rights Reserved
fanfictionfinishedforhonormalereadermalewardenmercypeacekeeperreaderreaderxcharacter
Table of contents

11 parts

Sign up to add The Fallen Legion: The feeling of sorrow to your library and receive updates
or
#2forhonor
Content Guidelines
You may also like
Why do we Fight? - Volume II - For Honor by ArcanePanzer
28 parts Complete Mature
The continuation of the story as it follows the lives of Argen Lorderius (The reader) and the inhabitants of the scarred lands from the Cataclysm, all of which are at odds with each other, where peace seems impossible. Follow the adventures of Argen and of the Vikings alongside Amber and the Lightshield Cohort in their quest to find a solution to the chaos that has raged and destroyed through the lands... A year have passed since the loss of Svengard, they now have shifted their attention to the Vikings in disarray. Argen, with the help of the late jarl, Gudmundr Branson, his friends and his reunited father, will make sure that the Vikings will get their revenge in due time. One way, or another. ++++++++++++++++++++ OC x Male Reader Insert Started writing Volume 2 a few days after I finished Volume 1. Though took me too long to upload since I was busy clearing out my requirement along with graduation on May 8, 2018. Anyways, here it is: Volume 2!
The Warden | A For Honor Fanfiction by DeadLight63
46 parts Complete Mature
Three years have passed since Blackstone's fateful attack against the Viking stronghold of Svengard. In the following years, Ashfeld has only grown more violent and unstable. Amongst the growing bandits and instability , a lone Warden wanders, legion-less, and guilty. Seeking atonement, the Warden seeks both ways to ensure his own survival, and to restore his lost honor.
A Wolf Among the Sheep by The_Nocturnal_Raven
57 parts Ongoing
After her final and greatest victory, Apollyon, Warlord of the Blackstone legion, dies in honorable combat with the Emperor's Champion... ...but it isn't the end. Reborn in a new world, which upholds a fragile peace, Apollyon quickly realizes that she has to remind humanity yet again what they are... her wolves.
Warriors: Shattered Trust ~Book 4 Series 3~ by skystxr
31 parts Complete
Time is running out. Tensions are high, and NoName's perfect empire is slowly crumbling. Following a horrible turn of events, Shadeheart is forced to make a bone-chilling decision that could only end in the death of someone he holds dear. And far beyond NoName's reach is Silvershy, who, after recovering from her sudden escape, discovers a secret she thought would never resurface. - Book 4 of series 3 'Born In Blood.' Look for the first series 'Will Lightclan Surive.' Look for the second series 'Lightclan's New Beginning.'
CROWNED by justonii
17 parts Complete Mature
[completed] If you stood before the Gods at this very moment, would they name you worthy of their domain? Would they look upon the fear you've caused and admire it? Would they pick upon your power and name it almost divine? That was the very thing Asdis Shadoweye craved the most. A life away from her father's shadow, filled with power and fame. However, her Fate trembles beneath her feet when she crosses paths with the very son of Ragnar people fear the most. ❝Power is dangerous. It corrupts the best and attracts the worst. Power is only given to those who are prepared to lower themselves to pick it up❞ -Ragnar Lothbrok !Includes NSFW, mature themes, strong language, violence and gore!
Ember by AngelBlueEyes0
20 parts Complete Mature
The night sky fills with the burning embers and smoke. Faint screams and hatred fill the air as I watch as the heart of my suffering burn in beautiful a shade that looks as stunning as morning glow. I inhale the chaos as if my life depends on it like the psychotic bitch they carved me to be. I will watch it all burn to protect my pups and purge this world. ******************* Silas Augustus Evensen A bitter 25 year old hybrid. Carries the last name of his viking ancestors that traveled and spread darkness. Holds the title of werewolf and Lycan king. A shifter that has human, lycan and werewolf form. Given up on a mate and spreading his dark heart across the continent he now calls home. He doesn't want anyone in his way to global victory. Remi-Rain Astrid In the supernatural world is a complete disgrace. 22 years old with 2 pups. The hybrid hides her abilities that were passed down by her father the previous Alpha of Black Forrest pack, who was brutally assassinated. Held prisoner in her homeland and being used is only fueling her internal fire. Looking for a way out with no idea what she is in for when she frees herself and her young pups. ***first couple chapters are slow. The pace will pick up but won't be a fly threw book. This contains graphic violence sexual, physical and mental abuse. No warnings other than in the description and the introduction. This is the first warning!
Why do we Fight? - Volume I - For Honor by ArcanePanzer
37 parts Complete Mature
Good soldiers follow orders, but true warriors know what is right. Since the start of civilization, soldiers have been a part of every society. They are trained only for one thing: War. Though it is not necessarily a part of the human mentality, it has existed and ravaged over the millenias. Occasionally, a soldier would ask himself: "Why do they fight?" "Is it really worth the lives of our brothers and sisters?" ... "Does love bloom in the darkest of paths?" ++++++++++++++++++++ OC x Male reader insert Slow paced romance and may include in-game characters with actual personalities and interactions that I made myself, because come on. Naming NPCs without backstories? Makes the story kind of bland for me but meh, that's my opinion. Default name for the reader is 'Argen Lorderius.' Btw, I do not own any pictures and other stuff in the fanfic. Refer to the disclaimer on each chapter :/.
The lost lion by Jaybird_Dragon2021
24 parts Complete
A human believes her life has been loyal to the right side of the war, but what happens when her whole life has been bases on lies and when a lion random saves her even though shes only met it once.
The big bad wolf loves me(old) by midnight_newt
23 parts Complete Mature
"WYNTER GET YOUR ASS BACK INSIDE THIS HOUSE! I KNOW YOU'RE OUT THERE. DON'T MAKE ME COME AND GET YOU!!" The male voice shouted. I can't let him see me I thought to myself as I looked at my mate one final time So wynter is my little mates' name. How cute. Wynter prepare yourself. You will be mine. I thought to myself as I sneaked back into the direction I came from. ------------------------------ (Warning I am bad at descriptions) Meet wynter Delaney, she is a 16 almost turning 17 years old who has been in a two- year relationship with a man much older than her. She had to move in with her boyfriend because of her sudden parent's death. They died in a horrible car crash. Her life is somewhat normal but that all changes when a certain someone comes into her life more than once. Meet Ryder Jones, he was an orphan at the young age of 6. His mother was murdered along with her old pack. His father committed suicide when he couldn't deal with the loss of his mate. But the blood moon pack came and took him in. Fast forward a few years later he is 18 and now just starting public school at coral high Where a certain someone goes to. He is the cliche bad-boy, maybe just not as bad. But he does have bad boy vibes and he is an alpha. Finally, meet Wynter's boyfriend of two years carter Rons. He works for the police and is 22 years old. He is anything but truthful to the one he supposedly loves. They all have separate lives but somehow they all connect to each- other. Join them on their adventure. But be warned people are just as dangerous as any animal. Will wynter accept the bond? Will she escape from her nightmares? Will she fall Inlove along the way? Will Ryder ever get the girl?
Bitter by scarletwidow06
43 parts Complete Mature
When Bucky believes his cousin over his fiancee, and ruins her life. She decides to start a new life in a new city with Natasha by her side. When Bucky finds out the truth, will she be willing to forgive him for all that he did or will what they once had be gone forever?
You may also like
Slide 1 of 10
Why do we Fight? - Volume II - For Honor cover
The Warden | A For Honor Fanfiction cover
A Wolf Among the Sheep cover
Warriors: Shattered Trust ~Book 4 Series 3~ cover
CROWNED cover
Ember cover
Why do we Fight? - Volume I - For Honor cover
The lost lion cover
The big bad wolf loves me(old) cover
Bitter cover

Why do we Fight? - Volume II - For Honor

28 parts Complete Mature

The continuation of the story as it follows the lives of Argen Lorderius (The reader) and the inhabitants of the scarred lands from the Cataclysm, all of which are at odds with each other, where peace seems impossible. Follow the adventures of Argen and of the Vikings alongside Amber and the Lightshield Cohort in their quest to find a solution to the chaos that has raged and destroyed through the lands... A year have passed since the loss of Svengard, they now have shifted their attention to the Vikings in disarray. Argen, with the help of the late jarl, Gudmundr Branson, his friends and his reunited father, will make sure that the Vikings will get their revenge in due time. One way, or another. ++++++++++++++++++++ OC x Male Reader Insert Started writing Volume 2 a few days after I finished Volume 1. Though took me too long to upload since I was busy clearing out my requirement along with graduation on May 8, 2018. Anyways, here it is: Volume 2!

More details