Enchantress Heartstring
soulsinnercharm
  • Reads 1,714
  • Votes 674
  • Parts 39
  • Time 4h 11m
  • Reads 1,714
  • Votes 674
  • Parts 39
  • Time 4h 11m
soulsinnercharm
Ongoing, First published Jun 01, 2018
Mature
athenacreaturesdangerousdarkmagicenchantedfantasyfemaleprotagonistgreekmythologyhellhorror-thrillermedusamolestedmysteriousmythologyphoenixposeidonrevengesavingtartaruswatty2020wilderness
⚜️⚜️⚜️⚜️⚜️⚜️⚜️⚜️⚜️⚜️⚜️⚜️

HE WAS KILLED RIGHT WHEN I PROMISED TO RETURN TO HIM .............

⚜️⚜️⚜️⚜️⚜️⚜️⚜️⚜️⚜️⚜️⚜️⚜️

The deadly Greek Gorgon Medussa .  

The one who knows how to kill , who loves to kill .

What will she do when she was struck by fate to love ? 

Medussa is known in many myths as a cursed figure of evil.But what about being cursed in her real life?

She wakes up in the twenty first century devoid of any memories just some visions, more like haunting visions for her. Chained for eternity was what she thought as in the process of remembering her powers,being chained in an unknown cave she uses all her might to get free. 

One different day , a guy ,a human guy sets her free. Thinking of it as a fortunate event, she tries to hide her secret from the human guy being unknowingly attracted to him.

⚜️⚜️⚜️⚜️⚜️⚜️⚜️⚜️⚜️⚜️⚜️⚜️
All Rights Reserved
athenacreaturesdangerousdarkmagicenchantedfantasyfemaleprotagonistgreekmythologyhellhorror-thrillermedusamolestedmysteriousmythologyphoenixposeidonrevengesavingtartaruswatty2020wilderness
Table of contents

39 parts

Sign up to add Enchantress Heartstring to your library and receive updates
or
Content Guidelines
You may also like
Forever Yours by hpixley
40 parts Complete Mature
PUBLISHED! NOW IN BOOKSTORES!!! Get your copy today! Makaria Mavros is finally adjusting to life in a small town in southwestern Michigan, after moving from New York City with her mom. Meeting grandparents she never knew about to making friends she never thought she'd make. Life is good. When her crush and the star of their high school basketball team begin to take notice of her, she finds that her life isn't what she thought it was. On top of all that, she also sees things that no normal human should be seeing, zombies and ghosts. She's the only one who can see them. It doesn't happen often, but often enough that Makaria is starting to wonder if she's losing her mind. Meanwhile, Ian Wallace is here to protect her. Star point guard of Mt. Olympia High School basketball team, he's got secrets of his own that he must keep keeping her safe. When things start happening before their time, Ian must decide what is best for the girl and for himself. When the orders change from keeping a distance to staying close, Ian realizes that she's the key to his future and all he holds dear. When it is revealed that someone is trying to release the Titans from their prison in Tartarus, Ian and Makaria find they must work together to stop the impending apocalypse from happening. For Makaria, it's a time for her to learn and use the powers she's been given. For Ian, it's a choice of life or love.
Valentine II. by mammijj
33 parts Complete
Peering up at him, I can tell he knows everything. My plans to take his crown... again. To free myself of his iron grasp forever. To twist my knife into his cruel, cold heart. He knows all of it. We've long passed fear, by now. 'The Damned King in all his glory' I mock to myself again smiling ironically at my predicament, my heavy chains scraping against the cold, marble floor. "Aww", coos Valentine murderously from the dais. *--------------------------------* Warning*: This title is not for the faint of heart. Please read with caution. Sequel to Valentine I, from the 'Valentine' series. #1 Mortal - 03/30/22 #2 Interracial - 08/03/22
The Gates of Tartarus | I ✓ by fandomsarehorcruxes
46 parts Complete
❝ SOULMATES END IN TRAGEDY JUST AS OFTEN AS THEY END IN FORTUNE. ❞ In which Eden Hills is surprised by a visit from someone she never knew could've existed, and thrust into a world she never would've thought she would be in, but that's the least of her worries. People who want her dead are now out for her blood. Her past is catching up to her, and she isn't sure what she should do when it finally does. The only problem is, she can't quite seem to remember her past... * * * Book One of "The Heroes of Old" Trilogy. Highest Rankings: #1 in Apollo. #1 in Deities. #1 in Hermes. #1 in Olympus. #1 in Gods. #1 in Eden. WARNINGS: War and murder. Self-deprecating humor. Mentions of rape. PTSD. Some detailed, gore-y battle scenes.
Serpent and Stone by PaintingTheRosesRed
30 parts Complete
❛The hero isn't supposed to love the monster...❜ A retelling of the story of Medusa. Medusa has been cursed since birth, a monster feared and hated by all. Longing to see the world but resigned to her cruel fate, Medusa expects to spend the rest of her days alone on her island, where she cannot hurt anyone. When a wounded soldier suddenly appears on her shores, Medusa begins to wonder if the Fates have another destiny in store for her.
The Serpent And The Mouse [A Medusa Love Story] by Reaper-fire
15 parts Ongoing
A blind woman, cursed by the gods and pursued by a suitor who wishes to control her. Seeking the aid of the gods she can't trust. Her life a constant state of fear and longing to be cared for has left this girl broken. Her escape leading her not into the arms of a protective God, but into the depths of Medusas domain. A mouse in the home of a serpent. Will she survive? Find the comfort and love that she seeks, or is she doomed to die in the darkness that is her world.
Protectress by 003shy
17 parts Ongoing
Imagine a city controlled by the irresponsible gods of the universe who torment the townsfolk as they carelessly unleash the world's greatest evils. This story of war between good and evil is told through the eyes of a mortal woman, who is turned into a hideous monster by the city's patron, Goddess Athene. When Goddess Athene is informed she will be dethroned by this mortal, she begins to plot her death, and with the help of the other gods, she sets free the contents of Pandora's box into the city. As demons and goblins terrorize the townspeople, it all comes down to this young woman, now seen as a dangerous Gorgon, to save the city of Athens. To Goddess Athene she is known as her enemy, but to the townsfolk she is known as the protectress of Athens. And to the rest of us, she is known as Medusa.
The Son Of Snakes by UnknownFate25
72 parts Complete
A monster. Cursed by the gods and feared by all. Medusa, the famed gorgon which turned those to stone with one look, had lost all hope in her life when she stumbled across that crying baby. She was ready to put the abandoned child out of its misery, but she wasn't ready to get attached. He was cursed too, and she couldn't help but see herself within him. And it was with that she decided to become his mother. Growing up with his mother in a shack in the forest, Nikolas was content with their life; until suddenly everything is thrown out of order when he loses his mother. But he refuses to let go so easily. He'll go anywhere to save his mother; even into the depths of Tartarus itself. This is the legend of Nikolas, the Son of Snakes. Volume 1 - The Son Of Snakes [In Progress] #1 greekmythology - 12/23/2022 #1 greece - 1/12/2023 #1 medusa - 3/27/2023 #1 original - 4/22/2023 #1 mythology - 5/18/2023 #1 fighting - 7/25/2023 #1 legend - 9/12/2023 #1 sliceoflife - 9/15/2023 (A Greek Mythology Harem Story) ***Notice. This story is inspired by Greece Mythology, but due to how much of a mess it can be and creative liberties not everything will be accurate***
When Moon Meets Sea: A Pertemis Story : The Prequel by Novastyles66
18 parts Complete
Percy Jackson, the greatest demigod hero walk on the Earth is betrayed by his kin. He has been thrown away by the Olympians for his supposed Crime which he Never imagined, in this situations he got interested in a certain silver eyed godess like he loved her from his previous life, is he right or he is wrong to love the woman he hold dearest, he still remember the Athenian girl who cost his life almost. I don't own Percy Jackson, Pjo, HoO, BoO,ToA, or any publications related to Rick Riordan,he does
You were made for me by o00NYX00o
15 parts Ongoing Mature
Lucian roux was afraid to love people. The last time he loved someone it didn't end well. He spent all his days alone, until her. She made living in this world so much more bearable and he promised that he would do whatever it takes. She was his leggera. Athena Faye didn't want to be in pain anymore. The person whom she thought she loved caused her too much pain already. She almost didn't believe in love anymore. Then she saw him, she fell for him. She was terrified, because the last time she fell for someone it ruined her. Two people who fear love, but also carve it more than anything.
The Eye of Sacrifice (DISCONTINUED FOR THE FORESEEABLE FUTURE) by GlitchedUser83
4 parts Ongoing Mature
(DISCONTINUED FOR THE FORESEEABLE FUTURE) A woman cursed with immortality spends years searching for a way to die, eventually she finds the Gordon Medusa. Seeing her suffering she blinds herself and helps her to cope with her pain and curse
You may also like
Slide 1 of 10
Forever Yours cover
Valentine II. cover
The Gates of Tartarus | I ✓ cover
Serpent and Stone cover
The Serpent And The Mouse [A Medusa Love Story] cover
Protectress cover
The Son Of Snakes cover
When Moon Meets Sea: A Pertemis Story : The Prequel cover
You were made for me cover
The Eye of Sacrifice (DISCONTINUED FOR THE FORESEEABLE FUTURE) cover

Forever Yours

40 parts Complete Mature

PUBLISHED! NOW IN BOOKSTORES!!! Get your copy today! Makaria Mavros is finally adjusting to life in a small town in southwestern Michigan, after moving from New York City with her mom. Meeting grandparents she never knew about to making friends she never thought she'd make. Life is good. When her crush and the star of their high school basketball team begin to take notice of her, she finds that her life isn't what she thought it was. On top of all that, she also sees things that no normal human should be seeing, zombies and ghosts. She's the only one who can see them. It doesn't happen often, but often enough that Makaria is starting to wonder if she's losing her mind. Meanwhile, Ian Wallace is here to protect her. Star point guard of Mt. Olympia High School basketball team, he's got secrets of his own that he must keep keeping her safe. When things start happening before their time, Ian must decide what is best for the girl and for himself. When the orders change from keeping a distance to staying close, Ian realizes that she's the key to his future and all he holds dear. When it is revealed that someone is trying to release the Titans from their prison in Tartarus, Ian and Makaria find they must work together to stop the impending apocalypse from happening. For Makaria, it's a time for her to learn and use the powers she's been given. For Ian, it's a choice of life or love.

More details