Story cover for The Blood of Idor'ae by CerealMilkKiller
The Blood of Idor'ae
CerealMilkKiller
  • WpView
    Reads 138
  • WpVote
    Votes 3
  • WpPart
    Parts 11
  • WpHistory
    Time 2h 11m
  • WpView
    Reads 138
  • WpVote
    Votes 3
  • WpPart
    Parts 11
  • WpHistory
    Time 2h 11m
CerealMilkKiller
Ongoing, First published Aug 27, 2018
Mature
alienanimebladeblooddarknessfantasyflameheavenhellotherwordlypainplanetpressurescreamseriesunknownwolf
The release of the unknown follows the goddess Demise's unleashing, as the blood of her sins cascades down the mantle of the damned. Unleashing what should remain bound, a formidable being emerges from the golden wall, disrupting the delicate balance of time dilation. Ashoria, once in harmonious equilibrium with the other districts, now hurtles forward at an accelerated pace, plunging into chaos and driving wedges through an already war-torn planet.

The once majestic Castle of Halls lies in ruins, a symbol of the devastation that has befallen the districts. Now, in the aftermath of destruction, a crucial question looms: Will the shattered leaders unite under the banner of a new savior, or is all hope truly lost? As the districts lay in total ruin, the fate of Ashoria hangs in the balance, and the urgent need for unity becomes paramount in the face of unprecedented calamity.
All Rights Reserved
alienanimebladeblooddarknessfantasyflameheavenhellotherwordlypainplanetpressurescreamseriesunknownwolf
Table of contents

11 parts

Sign up to add The Blood of Idor'ae to your library and receive updates
or
Content Guidelines
You may also like
The Cursed Orbit : fragment of fate by light02B
9 parts Ongoing
"The Cursed Orbit" When the Moon shattered, it wasn't just Earth that was thrown into chaos-it was the entire solar system. Each planet harbors an ancient secret: a colossal giant imprisoned within its core, chained since the dawn of time. Earth, however, is unique. Its prison is failing, and the giant within stirs, threatening to awaken. Haruto, an ordinary boy turned reluctant savior, is thrust into a world where fragments of the Moon grant godlike powers but at a devastating cost. As humanity teeters on the edge of extinction, Haruto must uncover the truth behind the giants, the celestial prisons, and his own cursed destiny. But every choice comes with a price. Save the Earth and become accursed himself, or turn away and unleash a titan capable of consuming the world. Bound by fate and burdened with impossible decisions, Haruto must walk the thin line between hope and despair in a battle that will decide the future of the universe. The orbit of destiny is cursed, and time is running out. Will Haruto rise above the chains-or be consumed by them?
War of religions by CristanRivas
11 parts Complete
Prologue What if I told you our world is a lie? A fragile stage where hidden gods move us like chess pieces, their celestial fingers dripping with the blood of mortal suffering. I didn't believe it... until they tore the veil from my eyes and cast me into the screaming darkness. This is the truth they kill to conceal: We were never meant to see behind the curtain. My name is Eva, and I am the mistake the gods wish they had erased. To survive their games, I'll bargain with the Devil himself. To win, I'll need my father's blessing. And to end this war that has raged since before light touched the Earth... I'll have to become something worse than the monsters hunting me. They want to use me as their pawn. I will be the hand that flips the board. ⚠️ THIS BOOK IS 100% FICTION ⚠️ All characters, events, and worlds depicted are products of the author's imagination. Any resemblance to actual persons, living or dead, or real-world entities is entirely coincidental.
《The Pact of Wolf - Blood 》 by 666Edward
31 parts Ongoing
In this world, there exists a well - kept secret - within the depths of every soul lies a wild seed. When 17 - year - old Alexander witnessed his father's tragic death on a full - moon night, his fate was completely transformed. The dormant wolf nature in his blood awakened, pulling him into an epic battle that concerns the survival of both the human and werewolf races. However, as he gradually gets closer to the truth, he discovers that his father's death is just the beginning. In this world full of betrayal and deception, Alex must find a balance between maintaining his humanity and unleashing his wild side, wavering on the verge of love and hate, and finally face the truth hidden in the shadow of the blood moon. Will he choose to be a hero who defends peace, or will he degenerate into a blood - thirsty demon? The fateful choice is right before him.
Cursed by Wicked_C
36 parts Complete
"You were born a Vampire Hunter. You were trained one and above all, you got some freaky spell on you that binds you to the Vampire princess. And still you think it's not right to kill them all because they might be innocent." When greed and fear get mixed up with powerful magic, the outcome isn't always what we expect it to be. Young vampire Hunter Sky knows this more than anyone. After an experimental ritual that would bring vampire kind to their knees, the world turns against the blonde Hunter. While finding refuge in the most unexpected places, a much bigger threat comes to light. With the world too caught up in their fear for the young Hunter, Sky and her new friends must stop the danger themselves and bring balance back to the world. *** Awards: 🥇The Chromatic Awards 2019 | Vampire/Werewolf | 1st place 🥇 Golden Petal Awards | Action scene (CH14) | 1st place 🥉 The 2nd Ohana Awards | Vampire | 3rd place 🥉The Scripturam Awards | Adventure | 3rd place ~ completed ~
Cursed with Desire (Bound by Desire #2) by LilaRosa34
108 parts Complete Mature
Alpha's daughter by title yet Omega by rank Leila Briar has had a difficult life. Alongside trying to heal from her family's murders she is the ridicule of the pack. The runt. But she is also looked down on because when the River Fern pack lost both their Alpha and Luna as well as their Alpha in training she was blamed and, as a result, made to live as the pack's slave. A far cry from the upbringing she should have had based on her position. In another realm after taking down the corrupt King and Queen of Aerilion as well as Laurel, the leader of a Coven hell-bent on re-writing the world as they believe it should be, Hunter and Rosalia are settling into their routines as leaders but Ash can't forget Rosa's words to him on the two's Crowning Ceremony: I know how to find your mate. Feeling lost and alone Ash knows he will do everything to help but when it is revealed who she is tensions rise and Ash tries to keep his distance from her, knowing what her reaction would be if she was to discover who he really was. But Leila can't stop dreaming of a black wolf with gold markings. A creature she hasn't seen yet feels an undeniable attraction to. Something she thought she'd never experience due to her status and being mistreated by those she called family. When she runs away from home and fate pulls the two together can they resolve their differences in time for Ash to save her from becoming enmeshed in a war not yet won? Or will darkness claim her as it has the others involved?
The Mongrel by SolanaaaaTrinidad
9 parts Complete Mature
A sin, born from the seeds of transgressions, spreads its roots deep into the soil of corruption, staining the once-pure lands with the crimson hue of tainted blood. While in the shadowy recesses, darkness stirs, ready to rise once more. Unbeknownst to the oblivious beasts that roam every domain, A looming calamity awaits. Its arrival is imminent, and its impact will be cataclysmic. Only by unearthing the crux of sin can the crimson lands be cleansed, but this redemption comes at a price, a sacrifice that must be made. Within the realm of an elven prophecy, these words hold a mysterious power, foretelling a tale of darkness, redemption, and the struggle for salvation. As the young hybrid of elven and part human-werewolf blood Vera Anastasia navigates the intricacies of her everyday life, she unknowingly becomes entangled in a web of fate, where her choices will shape not just her future but everyone else. Little did she know that fate had already set its sights upon her, and her journey towards self-discovery would intertwine with the ancient prophecy, unleashing forces beyond her wildest imagination. One that even Gods have no control with. Will she be eaten or will she prevail?
parasite by maniac_zahwah
75 parts Complete
The city breathes decay. A miasma of rot and despair hangs heavy in the air, clinging to the crumbling buildings like a shroud. Within the dilapidated apartment complex that serves as the backdrop to our story, something far more sinister lurks. A parasitic infection, born from the shadows of unchecked scientific ambition, is transforming humans into grotesque parodies of themselves - monstrous creatures driven by primal urges and a hunger for flesh. Into this nightmare stumbles Luna, a young woman previously bound by debilitating physical limitations. But the very infection that ravages her neighbors also grants her extraordinary abilities - the power of movement and speech, a strength beyond comprehension, and a terrifying control over the very parasite that threatens to consume her. The world she once knew, confined to the confines of her own body, is shattered, replaced by a maelstrom of violence and survival. Armed with a katana - a symbol of her newfound power and defiance - Luna navigates a landscape of horror. Her journey is not merely a desperate flight from death, but a relentless struggle for control, for identity, and for survival. Her path intersects with Lucca, a fellow resident of the building, who finds unexpected strength as a reluctant ally. Together they face not only the hordes of infected monsters, but also a shadowy private scientific group that seeks to exploit Luna's unique abilities for their twisted experiments. This is a story of metamorphosis, a brutal and beautiful transformation. It is a descent into darkness, a journey through a landscape of fear and violence, where hope is a fragile flame flickering in the face of unrelenting horror. Prepare to witness the rise of a warrior, born from the ashes of despair, a heroine forged in the crucible of survival, ready to confront not just the monstrous horde, but the deepest darkness within herself. The fight for survival is only the beginning. The true battle lies within.
Legacy of the Wolfbound: Rise of the Silver Howl by DonaldDove3
15 parts Complete
Book 1 In a world where ancient magic and primal forces intertwine, Eira of the Bloodmoon embarks on a perilous journey to unite the fractured packs of the Wolfbound against an encroaching darkness. After surviving a harrowing Hunt and proving her strength by slaying the Myrkorak, Eira awakens an ancient legacy that ties her to the powerful Silver Howl-a force that could reshape the fate of her people. As tensions rise with the Shadowborn, a ruthless enemy determined to awaken a long-dormant evil, Eira must navigate a treacherous path. With the support of her companions, including the fierce warrior Alaric and the proud leader Lira of the Frostpaw pack, she sets out to forge alliances among the fractured tribes. Each pack presents its own challenges, testing Eira's courage and resolve as she faces trials that will push her to her limits. In this epic tale of bravery and destiny, Eira discovers that true strength lies not only in her newfound powers but also in the bonds she forges along the way. As the shadows loom ever closer, she must confront her fears, embrace her legacy, and rally the Wolfbound to stand against the darkness threatening to engulf their world. Legacy of the Wolfbound: Rise of the Silver Howl is the first book in a thrilling fantasy series that explores themes of unity, sacrifice, and the indomitable spirit of those who dare to rise against the tide of darkness. Join Eira as she navigates a world filled with magic, danger, and the untold power of the Wolfbound.
Sacrifice in Blood by AutumnVVitch
66 parts Complete Mature
Leina Thornton, a newly initiated witch, finds an unexpected ally in an immortal enemy, a vampire, and must fight to survive in order to defy an ancient prophecy which foretells chaos and death. The once quiet town of Woodcreek becomes the centre of supernatural events. Caught in the middle of a war between witches and vampires, Leina and Talon have no place being friends, but as much as they try to stay away from each other, they can't escape destiny. An ancient prophecy divines that an Elemental witch and Pureblood vampire will together, unite the two races in peace, or bring chaos and destruction to the world. Which will it be? And how far would you go to protect the ones you love? "You should know by now I'm pretty stubborn. You can't make me do anything. I don't care if the universe says we shouldn't be together. The fact that we're blood-bound means we literally can't run away. I don't want to run away, we're better off together."
Human Killer by mckaylaspandas
35 parts Complete Mature
Death is a part of life, it all comes to us at some point. werewolves are hidden in society, only hunters know about it. Hunters who enjoy trying to kill out the race, but now its the werewolves turn to take matters into their hands as a new world will be born into a painful chaos. Ericka had a normal life, friends, family, shopping, sleepover, everything a teenager does and has, until the one night when she watches her best friend get killed by a wolf, but not just any wolf, a werewolf. The horror of watching her friend die sends her to a frenzy, but she ends up in trouble when the alpha decides to keep her into his own hands and brings her into his own world and plans. A dark plan to kill humans for the revenge of their own kind. But what if Ericka can change that before it's to late? Can she make it through this horror or die trying?
You may also like
Slide 1 of 10
The Cursed Orbit : fragment of fate cover
War of religions cover
《The Pact of Wolf - Blood 》 cover
Cursed cover
Cursed with Desire (Bound by Desire #2) cover
The Mongrel cover
parasite cover
Legacy of the Wolfbound: Rise of the Silver Howl cover
Sacrifice in Blood cover
Human Killer cover

The Cursed Orbit : fragment of fate

9 parts Ongoing

"The Cursed Orbit" When the Moon shattered, it wasn't just Earth that was thrown into chaos-it was the entire solar system. Each planet harbors an ancient secret: a colossal giant imprisoned within its core, chained since the dawn of time. Earth, however, is unique. Its prison is failing, and the giant within stirs, threatening to awaken. Haruto, an ordinary boy turned reluctant savior, is thrust into a world where fragments of the Moon grant godlike powers but at a devastating cost. As humanity teeters on the edge of extinction, Haruto must uncover the truth behind the giants, the celestial prisons, and his own cursed destiny. But every choice comes with a price. Save the Earth and become accursed himself, or turn away and unleash a titan capable of consuming the world. Bound by fate and burdened with impossible decisions, Haruto must walk the thin line between hope and despair in a battle that will decide the future of the universe. The orbit of destiny is cursed, and time is running out. Will Haruto rise above the chains-or be consumed by them?

More details