Path of Legends HxD
ItheraelFF
  • Reads 37,551
  • Votes 460
  • Parts 3
  • Time 5h 27m
  • Reads 37,551
  • Votes 460
  • Parts 3
  • Time 5h 27m
ItheraelFF
Ongoing, First published Sep 05, 2018
Mature
action-adventureadventurebattlecrossoverdxdepicepicfantasyfantasyfiercedeitymaskfightinghighschooldxdhyrulewarriorslegendofzeldalinkmagicmajorasmasknintendoocarinaoftimeromanceromance-friendshipvideogameszeldafanfiction
From an ideal, a dream is created. This dream gives birth to hope. From hope, courage is forged. Courage springs forth the spirit. And from the spirit, a legend begins. 

Destiny... said to be cruel, fearsome, unbreakable... It dictates the flow of time, it dictates the flow of history. The indestructible chains that bind it, that made it unchanging and unavoidable, were now painted Crimson. A new journey, a new world, where Gods were not out of his reach, where Evil was powerful and mighty, Link will rise and become a legend. This is his tale.
All Rights Reserved
action-adventureadventurebattlecrossoverdxdepicepicfantasyfantasyfiercedeitymaskfightinghighschooldxdhyrulewarriorslegendofzeldalinkmagicmajorasmasknintendoocarinaoftimeromanceromance-friendshipvideogameszeldafanfiction
Table of contents

3 parts

Sign up to add Path of Legends HxD to your library and receive updates
or
Content Guidelines
You may also like
Trigger by byebyebye132
14 parts Complete Mature
When Ghirahim's eyes slid open, he was in an unfamiliar bedroom, laying in a bed that was unnecessarily large for just one person. It was a moment later, when something shifted, that he realized there was more than just one. ... "Who are you?" "I actually...don't know much more than a name. Ghirahim. Who are you?" "Same as you. Don't have anything but the name. It's Link." ... They woke up next to each other with no knowledge of who they were or why they were together in an empty bedroom, only half dressed. They only knew that they did not belong in this world, a modern world where people carried guns and talked on phones and drove in cars. Rated Mature for adult themes. Complete.
The Legend of Zelda: The King's Sword by DarkLafayette
25 parts Complete
[Under Revision] Succeeding the events of The Legend of Zelda: Skyward Sword... (Rated PG-13, may be inappropriate for children under thirteen) Link and Zelda descend from the clouds begin their lives in marriage. They continue to discover the wonders of the Surface, but obstacles from their shared past weigh their hearts and hinder their intimate desires. As I write, my innocent mind grows as much as Link and Zelda's relationship does. Instead of being afraid to share these, I proceed to look upon this as sharing my growth as a writer and a huge release of my secret world unto you, dear reader. WARNING, my lovelies, this piece contains blood, language, and suggestive themes. Not to scare you or anything, but please, viewer discretion is advised. The Legend of Zelda characters and games belong to Nintendo and the blessed people who created the beloved franchise. I'll add the rest of my illustrations probably after I finish writing my chapters so, apologies for my inconsistency. Happy reading this far-from polished imagination!
The Legend of Zelda: The Hero Reborn (Modern Adventure AU) by sheikahtypebeat
10 parts Complete
As Time's Wheel turned, Hyrule's ancient legends of kings, queens, and heroic knights in green slowly faded into myths. In the modern day Hyrule, everything seemed perfect; its economy flourished, its stocks rose like never before, its citizens were happy, and its military was one of the best in the world. That is all until Hyrule's neighboring nation, Gerudia, conducted a large scale invasion of its surrounding countries. Led by the former leader of a terrorist organization known for causing mass genocide and destruction, Ganondorf Dragmire and his nation plan to show the world the true power of a long forgotten magical element. ------------------------------------------------------------------------------------------------------- Welcome to my next big story! I have some great ideas for this, so I hope you all enjoy. Cover art: made by me!
Zelda: Celestial Shadows by GlitchedJam
12 parts Complete
In a world where legends intertwine with reality, the kingdom of Hyrule faces an unprecedented threat. A celestial being known as Aetheris has descended from the stars, unleashing chaos and darkness upon the land. As panic spreads and hope wanes, Princess Zelda and the courageous hero, Link, embark on a perilous quest to restore peace. After a harrowing battle in the Hebra Mountains, they discover a powerful stone that holds the key to uniting Hyrule against the encroaching shadows. With their bond stronger than ever, Zelda and Link set out on an epic journey to rally allies from the four corners of the kingdom-the noble Zora, the stalwart Gorons, the fierce Gerudo, and the vigilant Rito. As they traverse breathtaking landscapes and confront ancient enemies, they must forge alliances and ignite the spirit of unity among Hyrule's diverse peoples. But lurking in the darkness are remnants of Aetheris's power and other sinister forces, ready to thwart their every move. In this first installment of the Celestial Shadows saga, readers will be captivated by a richly woven narrative of friendship, bravery, and the enduring fight against darkness. With stunning visuals and an immersive world, the story unfolds as Zelda and Link discover not only the strength of their allies but also the unbreakable bonds that will shape the future of Hyrule. Join them on this thrilling adventure filled with magic, mystery, and the timeless battle between light and shadow. Will they unite Hyrule in time to stand against the looming threat, or will darkness consume their beloved land? The fate of Hyrule hangs in the balance as the call to arms echoes across the skies.
Legend of Zelda: Blue Maiden (OT-MM) by Frozenbeenie
35 parts Complete
The Future Hero of Time, Link's Triforce within his left hand has broken off into 12 pieces. Because Link's Triforce had broke, it took along his own emotions. When breaking away from his main body, the pieces had created identical bodies to match the personality that was lost. Every one of the Links are placed through out Hyrule, having their own lives in the child era and adult era •Loneliness: A servant in Zora's Domain •Disappointment: A rancher in Lon Lon Ranch •Sorrow: A best friend in Death Mountain •Affection: A womanizer in Kakariko Village •Fear: A Lost child in the Market •Curiosity: A child in the Lost Forest •Loyalty: a Wonderer in Hyrule Field •Regret: a prisoner in Gerudo's Fortress •Love: A assistant in Lake Hylia •Pride: a thief in Gerudo Valley •Magic: a knight protecting the Master Sword •Hope: A piece of the Triforce on Lina's necklace Lina is a girl who's suddenly got herself from one world to the real world in the Legend of Zelda game. Getting a important task, she's destined to help Link put his heart and Triforce back together, she'll have to go through many task just to create the hero of time and have him save the peace in Hyrule. Along the way of exploring, Lina finds out she's someone truly mysterious and important when having magic herself. Wanting to know who she is, she has to do much more than exploring Hyrule, she has to find her 6 lights that made their own lives and take aid from the goddess of time Made 2016
The Legend of Zelda: What Comes After - The Final Tale of The Hero of Time by sheikahtypebeat
14 parts Complete
After defeating Majora in heated showdown in the mysterious land of Termina, the Hero of Time attempts to make his way back to Hyrule. ----------------------------------------------------------------------------------------------------------- Yes, this is the fully revised and second version of the story! Enjoy! ----------------------------------------------------------------------------------------------------------- Have you ever wondered what happened to the Hero of Time after Majora's Mask? How did he become the Hero's Shade? How is the Hero of Twilight a direct descendant? Did he find Navi? How did he die? What Came After?
Stay With Me (Dark Link x reader ) COMPLETE by glitchfreak101
20 parts Complete
A depressed girl who only wanted to be accepted after losing the people who loved you most. Right when you were about to end it all, your knight in shining armor saved you from your hellish life. Being with him you learn...whats going to happen? Well you have to read to find out dear reader-chan~ XD (if you can't handle people cussing I'm sorry.) Please don't self advertise. I wouldn't do it to you so please don't do it to me... Other than that enjoy Cover made by me! Also, the account that wrote about my story being well writen wasnt made by me. It was made by the original creator before I became moderator of the accout. you can check on their account for more details
The Legend of Zelda: Dreaded Destiny by masquerade_magic
6 parts Ongoing
Link, a young knight in training, learns he is chosen with securing Hyrule's future. He sets off on a journey accompanied by a girl with the same mission to remedy the world of a new evil. As they face many trials and discover hidden truths about one another, will they have the resolve to continue? Will Link be worthy of the green tunic that so many heroes wore before him? Or will he dread destiny? ◉ PRESS ANY BUTTON TO START ◉ .................................................................................... Welcome to my first story! I'm an artist and I've never really been good at writing, but I've had this story idea for a while now and I needed to get it out of my system. Please enjoy! This story doesn't take place in a particular game, however there will be references to several. -The Legend of Zelda franchise is created and owned by Nintendo -All artwork is done by me
The Legend of Zelda - School of the Wild by zeldaslink7
11 parts Ongoing
Zelda Hyrule's life has always been one that is not her own. Zelda Hyrule has always been the spitting image of what her Father wants her to be. She has never broken a rule. That being, never been out past 9 pm, has never cut a class, and most importantly, has never, ever had a boyfriend. She goes to her private academy like her Father wants, and that's the end of her story. However, her fate takes an unfortunate turn when she accidentally gets herself blamed for something she didn't do and is expelled. Now, with her Father furious with her, she has no choice but to finish out her high school years at a regular public school. She has her eyes set on clearing her name, and no intention of staying in this crappy public school. As if by pure sheer coincidence, or maybe it was fate, she meets Link. Link, the silent superstar of the school, who, in her hour of need, comes to her side with no hesitation. She is undoubtedly drawn to him, yet she needs to stay away. As she progresses day by day, she meets a couple of new friends, and even a few enemies. Will Zelda clear her name? Or will she stay in this public dump for a couple of friends and a silent knight?
The Wind Waker by Awesome-astronaut
45 parts Complete
On a journey to save his sister, a boy is caught in a struggle older than the great sea. ====== One thousand years ago, the greatest hero of all Time fought against Time's greatest enemy. The people rejoiced in the victory, but when the evil returned, the hero did not. Watching the unstoppable destruction, the golden godessess buried the land of Hyrule in water, keeping their foe from conquering the kingdom. Hyrule is now only a word on a page to the people on the great sea. Even though Hyrule is lost to them, they still cling to old traditions. And after all these years, the era without a hero will finally end. The legends will be reborn. Reborn on an ocean breeze. Published also on Scribblehub, RoyalRoad, and Deviantart. The original game, the names of many characters and places are all originally created by Nintendo, and they are thus the owner of the characters.
You may also like
Slide 1 of 10
Trigger cover
The Legend of Zelda: The King's Sword cover
The Legend of Zelda: The Hero Reborn (Modern Adventure AU) cover
Zelda: Celestial Shadows cover
Legend of Zelda: Blue Maiden (OT-MM) cover
The Legend of Zelda: What Comes After - The Final Tale of The Hero of Time cover
Stay With Me (Dark Link x reader ) COMPLETE cover
The Legend of Zelda: Dreaded Destiny cover
The Legend of Zelda - School of the Wild cover
The Wind Waker cover

Trigger

14 parts Complete Mature

When Ghirahim's eyes slid open, he was in an unfamiliar bedroom, laying in a bed that was unnecessarily large for just one person. It was a moment later, when something shifted, that he realized there was more than just one. ... "Who are you?" "I actually...don't know much more than a name. Ghirahim. Who are you?" "Same as you. Don't have anything but the name. It's Link." ... They woke up next to each other with no knowledge of who they were or why they were together in an empty bedroom, only half dressed. They only knew that they did not belong in this world, a modern world where people carried guns and talked on phones and drove in cars. Rated Mature for adult themes. Complete.

More details