Story cover for Why me? by Blood_Pain_Death
Why me?
Blood_Pain_Death
  • WpView
    Reads 28
  • WpVote
    Votes 6
  • WpPart
    Parts 2
  • WpHistory
    Time 6m
  • WpView
    Reads 28
  • WpVote
    Votes 6
  • WpPart
    Parts 2
  • WpHistory
    Time 6m
Blood_Pain_Death
Ongoing, First published Sep 19, 2018
crueldesirehurtlifelovenatsukipainsadsadnessselfishnesswhyme
A story related with being famous and forgetting  about your close ones and those who probably sacrificed for you even if it's the smallest and cheapest thing on the earth. A story about a girl and boy who loves each other yet they don't dare to say it loud just because of the society.
All Rights Reserved
crueldesirehurtlifelovenatsukipainsadsadnessselfishnesswhyme
Table of contents

2 parts

Sign up to add Why me? to your library and receive updates
or
#440selfishness
Content Guidelines
You may also like
It's A Love Story (I Guess) by thataviguy
15 parts Complete
A story about Truth, Loyalty, Insecurities, Misunderstandings. A story about Love. It's a love story. (I Guess)
From Habit To Home by SamuritiaSamuRishaMe
9 parts Complete Mature
A story about a young woman who has to suffer the consequences of her first teenage relationship. As a grown woman with a happy family she now has to continue life with pain,loss and unanswered questions.
Lacuna De AME (The End.) by aksameee
10 parts Complete
In the second life later, I wanna live without this pain again. THE CURSE of LIFE.
Mixed Feelings | Natsuki x Yuri | DDLC by UncertainFate
20 parts Complete
Hardships are things that you expect to go through while in a relationship. So why was Natsuki and Yuri going through them even though they're just friends? Or maybe... more than friends? Their relationship may have indefinitely changed during the sequence of events that has happened throughout life. (Also Monika and Sayori are here)
the worst ❤️ by ishayla
17 parts Complete Mature
short story ; Lies , hurt , love .. but her life is the worst .
Dreamy Marriage | NaLu by BunnyLuce
35 parts Complete Mature
Forced to marry at 17, and worst of all, he hated her and she hated him. Or so she thought. After seemingly reliving her life, the blonde finds herself waking up one day, realizing that everything was not how it seemed. NaLu | P18
Please..!! Forgive me...Give me a second chance 🙏 (✔️) by RainygirlRimjhim
2 parts Complete
Sometimes we miss the first chance, so, we need the second chance to repent our mistakes which we did first, here this theme will be beautifully described🙂 Hope you will like the story of Beloved #swasan ❤️ ❤️ COMPLETETED STORY❤️ This is a short story based on just two parts ( we can called it Two Shot ) I hope you should enjoy this story ☺️
The Tragedy Of Life by Thinking17
4 parts Complete Mature
For my best friend. A story of life, death, and true tragedy. Directed towards all those who can never feel it.
THE BRIGHTSIDE by Delster_thatgirl
28 parts Complete
a single mother struggling to feed her own daughter everyday, will her own daughter found herself in the same position or will she find the brightside of her life?
Fairy Tail High (Natsu x Bullied! Reader) by tudogg
25 parts Complete
You are a depressed girl who gets bullied everyday and are so close to just giving up when a certain salmon haired boy enters your life.... WARNING: HAS MENTIONS OF DEATH AND POSSIBLE GORE but also love so don't get to scared ;)
You may also like
Slide 1 of 10
It's A Love Story (I Guess) cover
From Habit To Home cover
Lacuna De AME (The End.) cover
Mixed Feelings | Natsuki x Yuri | DDLC cover
the worst ❤️ cover
Dreamy Marriage | NaLu cover
Please..!! Forgive me...Give me a second chance 🙏 (✔️) cover
The Tragedy Of Life cover
THE BRIGHTSIDE cover
Fairy Tail High (Natsu x Bullied! Reader) cover

It's A Love Story (I Guess)

15 parts Complete

A story about Truth, Loyalty, Insecurities, Misunderstandings. A story about Love. It's a love story. (I Guess)

More details