A Traitor's Tale
bluestar514
  • Reads 62
  • Votes 2
  • Parts 7
  • Time 1h 9m
  • Reads 62
  • Votes 2
  • Parts 7
  • Time 1h 9m
bluestar514
Ongoing, First published Oct 02, 2018
adventureassassinbetrayaldeathdemonhighfantasyknightsmagesmagicmedievalmysterynanowrimonanowrimo18princessretributionroyaltysecretstragedytruth
The crown prince is murdered during his coronation by the most hated mage in all of the kingdom's history. 

Several years later, at the urging of the young princess, Knight-Captain Rose Delores recounts the story. 
Of the murdered prince. Of the mage. Of a band of adventurers and close friends. 

Of betrayal and loss.
All Rights Reserved
adventureassassinbetrayaldeathdemonhighfantasyknightsmagesmagicmedievalmysterynanowrimonanowrimo18princessretributionroyaltysecretstragedytruth
Table of contents

7 parts

Sign up to add A Traitor's Tale to your library and receive updates
or
#497mages
Content Guidelines
You may also like
Celestine by AkemiKitagawa
9 parts Ongoing
☆☆☆ Serena Castille was only seven years old, when her mother was killed. Ever since then, she swore to herself that she would have her revenge, but what if the killer was the Duke of Lunaria, her father? Her father trained her, forced her to be an anonymous assassin who puts the lower Lords of Lunaria back in their places, she became a monster, a cruel woman, and a heartless, unmerciful killer. Even though deep down, she was a healer, a person who tends to others, the kind of people who are the purest form of life, she devoted her life to kill and survive on her own Even when Serena knew who her mother's murderer was, as the Princess of Lunaria, she helplessly fell into her father's game of power. Her father sent her to the Suncrest Domain to retrieve the Emperor's Crystal Staff, which was left in the hands of the Duke of Suncrest, Lord Lucius Calyx, who was an elemental. As she tries to steal it from him, they get entangled with each other, and Serena unravels every single secret which both her father and Lucius hid from her. ☆☆☆
Shadow And Light by Hanna B.H by HannaAuthor
11 parts Ongoing Mature
In a kingdom where magic wandered , and those who can wield it deemed guilty and traitors , lived a young assassin between the shadows who wanted nothing but to avenge her parents murder. Her plan didn't go as she wanted it to be , and now she has to go look for a forgotten relic made of forbidden magic so it wouldn't end up in the hands of her most hated enemy , the king of the kingdom himself. She thought she knew everything about herself and her life , turned out there was more. Haunted by the shadows of her past and future , she ends up working with the only person she has to stay away from. The prince ,her enemy's son , her partner in the searching and haunter. She has always walked through darkness. haunted by the shadows of her past. Until him.
Kingdom's Queen by d0ll_sa1t
39 parts Ongoing
The story of a girl who was abandoned as a baby, left with no name and no one to call family. She grew up as a maid, working hard to make a living in the kingdom of Venus. Little did she know, she had a crazy secret about to turn her life upside down. When she discovers the truth, she must find the strength to save her kingdom and friends from evil Magic Keepers who seek to destroy everything she holds dear. With the help of her newfound allies, she embarks on a dangerous journey to reclaim her rightful place and restore peace to her land.
Reaper's Bane by Shimmer
4 parts Ongoing
The world was forever changed when the Aether imploded, taking the regenerative abilities of our magic with it. Now magic is dying and it's taking the kingdom with it. Four royal houses must maintain keep the kingdom from crumbling by ensuring magic doesn't disappear. And all is going according to plan, the heirs are ready to receive their powers and begin attending Havenhurst Academy to become the rulers they were destined to be. But a scorned assassin, known as the Reaper, throws a wrench into those plans when her presence at the transference ceremony ends with royal magic inside her instead. This wasn't exactly the plan, but it gets her one step closer to eliminating the royal houses and avenging her parents deaths. Forced to Havenhurst under the watchful eye of the heirs Amaris "Deirdre" Eldergrove must find a way to survive while trying to keep her true identity secret. She has a mission to complete but complicated feelings for the four men she's supposed to kill begin to get in the way. Add in the unraveling secrets that could change the world as they know it and the increasing possibility that she's the only one that can save it and she's feeling way out of her depth. She's a killer, it's literally in her job description. Saving people was never her strong suit, just ask her parents. They always say you can't teach an old Fae new tricks.
ɢɪʟᴅᴇᴅ ʟɪʟʏ ☆ ᴡᴇᴅɴᴇꜱᴅᴀʏ ᴀᴅᴅᴀᴍꜱ by LOV3RSHAWKE
41 parts Complete
𝙥𝙪𝙗𝙡𝙞𝙨𝙝𝙚𝙙 𝙤𝙣: 𝗳𝗲𝗯𝗿𝘂𝗮𝗿𝘆 𝗳𝗼𝘂𝗿𝘁𝗵, 𝟮𝟬𝟮𝟯 ˏˋ°•*⇢ ɪᴛꜱ ꜱᴏ ꜱᴡᴇᴇᴛ ᴋɴᴏᴡɪɴɢ ᴛʜᴀᴛ ʏᴏᴜ ʟᴏᴠᴇ ᴍᴇ ᴛʜᴏᴜɢʜ ᴡᴇ ᴅᴏɴᴛ ᴇᴠᴇɴ ɴᴇᴇᴅ ᴛᴏ ꜱᴀʏ ɪᴛ ᴛᴏ ᴇᴀᴄʜ ᴏᴛʜᴇʀ ₓ˚. ୭ ˚○◦˚.˚◦○˚ ୧ .˚ₓ ✧ 𝘐𝘷𝘺 𝘉𝘢𝘴𝘴𝘦𝘵𝘵 𝘸𝘢𝘴 𝘬𝘯𝘰𝘸𝘯 𝘧𝘰𝘳 𝘩𝘦𝘳 𝘰𝘤𝘦𝘢𝘯 𝘣𝘭𝘶𝘦 𝘦𝘺𝘦𝘴, 𝘧𝘪𝘦𝘳𝘺 𝘳𝘦𝘥 𝘩𝘢𝘪𝘳, 𝘢𝘯𝘥 𝘩𝘦𝘳 𝘭𝘦𝘨𝘢𝘤𝘺 𝘰𝘧 𝘱𝘰𝘸𝘦𝘳𝘧𝘶𝘭 𝘚𝘢𝘭𝘦𝘮 𝘸𝘪𝘵𝘤𝘩𝘦𝘴. 𝘈𝘯𝘥 𝘧𝘰𝘳 𝘧𝘢𝘭𝘭𝘪𝘯𝘨 𝘪𝘯 𝘭𝘰𝘷𝘦 𝘸𝘪𝘵𝘩 𝘞𝘦𝘥𝘯𝘦𝘴𝘥𝘢𝘺 𝘈𝘥𝘥𝘢𝘮𝘴, 𝘵𝘰𝘰. ⋆ ᴡᴇᴅɴᴇsᴅᴀʏ ᴀᴅᴅᴀᴍs x ғᴇᴍ!ᴏᴄ ᴡᴇᴅɴᴇsᴅᴀʏ [sᴇᴀsᴏɴ ᴏɴᴇ - ] ☆
ADA (Pride Of Alaocha Book 1) by Anthony-Godwin
2 parts Complete
It all started as a little spark in her chest, and then it grew and ignited her whole being with an outburst of emotion. Before she could recollect herself, she found out that she desired him more than anything in the world. She was madly in love. Ada was a palace maid, the most trusted servant in the palace. The king loves and cherishes her very much that he told her secrets that even the Prince himself does not know about. This led to conspiracy, anger, and jealously. The bitterness of betrayer ate Ada up when she found out that the man she loves most in the world, had tricked her into disclosing the location of the Ofor, the mantle of leadership in Alaocha, and had stolen it. Banished from the land as a traitor, Ada swore to find the Ofor and the man that had threw her into this misery. But things began to unfold when she found out that she was the rightful heir to the throne even though the culture and tradition forbids a female monarch. Without the Ofor the king is useless and the land is bare of the protection from the gods. Will Ada find this Ofor first? Will she save the village from the invaders coming from all angles Or Will, she let her emotions control her again when she finds the man that had ruined her life?
When Magic Speaks - NaNoWriMo 2020✔️ by invisiblesoil
30 parts Complete
With two worlds ripped apart by fear and magic, who (or what) will restore balance and peace? - Introducing my first ever NaNoWriMo project (ever) for NaNoWriMo 2020! This is my first time ever participating in this writing challenge and despite the many edits I'd like to make to my story along the way, I will be uploading each chapter as I complete them! Good luck to everyone participating this year! If you'd like to buddy up with me, my NaNoWriMo profile is @casuallybean ~ - While I take claim over my original characters, I do not claim any possession of the video links/songs linked in my story. Each belongs to their respective owners.
The Unsung Heir by asiangirl13
27 parts Complete
Fifteen years ago, Jane's whole family was massacred in one night by a rival family. That family then took Jane in to raise her, but after discovering her real background, Jane becomes determined to overthrow that family. Three princes, a bat, and a secret, will Jane finally restore her family throne or will someone betray her first?
Though The Heavens May Fall [hs] by celestialboulevard
23 parts Complete Mature
"Let justice be done, though the heavens may fall." A princess and a knight; fallen deeply, madly in love against all they've ever known. A kingdom; consumed by a veil of sinister secrets and deathly consequences. Nothing will ever be the same. ----- harry styles au royal / fantasy #1 in 'historical fanfic'- 01/30/21
The Octopus Queen (A Little Mermaid Retelling) by M_A_Hartman
29 parts Complete
A story of love, power, betrayal, and the corruption of an innocent soul. ------------ Melusine "Sina" Fisher grows up in the seaside village of Farbarrow, the only daughter of a widower father. Although bright and precocious, the limited curriculum provided by the village school leads Sina to be branded as "difficult" by her teacher and treated accordingly. All that changes when Sina saves a rare black octopus from a group of village boys. As thanks for her help, the octopus promises to grant the child one wish: "I want to learn." And so begins Sina's magical education. As she grows, so do her powers. With her reputation expanding beyond Farbarrow's narrow borders, Sina attracts the attention of Viscount Klaus Zeimet who captures her heart with a dashing smile and kind eyes. But not all noblemen's sons are gentlemen and happily-ever-afters can disappear in a puff of smoke. Loosely based on Hans Christian Andersen's "The Little Mermaid". [NaNoWriMo 2022] Cover designed by @lavendareyes
You may also like
Slide 1 of 10
Celestine cover
Shadow And Light by Hanna B.H cover
Kingdom's Queen cover
Reaper's Bane cover
ɢɪʟᴅᴇᴅ ʟɪʟʏ ☆ ᴡᴇᴅɴᴇꜱᴅᴀʏ ᴀᴅᴅᴀᴍꜱ cover
ADA (Pride Of Alaocha Book 1) cover
When Magic Speaks - NaNoWriMo 2020✔️ cover
The Unsung Heir cover
Though The Heavens May Fall [hs] cover
The Octopus Queen (A Little Mermaid Retelling) cover

Celestine

9 parts Ongoing

☆☆☆ Serena Castille was only seven years old, when her mother was killed. Ever since then, she swore to herself that she would have her revenge, but what if the killer was the Duke of Lunaria, her father? Her father trained her, forced her to be an anonymous assassin who puts the lower Lords of Lunaria back in their places, she became a monster, a cruel woman, and a heartless, unmerciful killer. Even though deep down, she was a healer, a person who tends to others, the kind of people who are the purest form of life, she devoted her life to kill and survive on her own Even when Serena knew who her mother's murderer was, as the Princess of Lunaria, she helplessly fell into her father's game of power. Her father sent her to the Suncrest Domain to retrieve the Emperor's Crystal Staff, which was left in the hands of the Duke of Suncrest, Lord Lucius Calyx, who was an elemental. As she tries to steal it from him, they get entangled with each other, and Serena unravels every single secret which both her father and Lucius hid from her. ☆☆☆

More details