Arcanium Falls
AlexRosora
  • Reads 116
  • Votes 22
  • Parts 10
  • Time 1h 21m
  • Reads 116
  • Votes 22
  • Parts 10
  • Time 1h 21m
AlexRosora
Ongoing, First published Oct 27, 2018
arcanecomedydemonicpossessiondemonsdwarveselvesepicfantasyfantasyherohighfantasyhumorknightslolmagicnanowrimonanowrimo2018ragstorichesromance
In the conquered land of Enoss, Samael is a mage living in the slums of the capital city, Archill. Starvation is a daily threat, as his immense magical powers eat away at him from the inside. He is also attuned to the whispering of demons, as all mages are. And the voices are as hungry as Samael himself.

The invasive Serandan military occupies Archill, and magic is now illegal. On the run from the ever vigilant mage-hunters, the Knights of Soma, Samael must find a way to survive in the worst conditions. But little does he know, the Knights of Soma would be the least of his problems.

When disaster strikes, he has no choice but to rise and seek opportunity in the ashes. Will his powers be his salvation, or will he be another meal for the crows?
All Rights Reserved
arcanecomedydemonicpossessiondemonsdwarveselvesepicfantasyfantasyherohighfantasyhumorknightslolmagicnanowrimonanowrimo2018ragstorichesromance
Table of contents

10 parts

Sign up to add Arcanium Falls to your library and receive updates
or
#31demonicpossession
Content Guidelines
You may also like
Faith is Fallen (Broken Fantasies Series) by theeternalscribe
65 parts Complete
Some fantasies aren't all they're cracked up to be... Cara, princess of the Seelie Fae, had always been meant for great things. Then, she is betrayed by her brother, and left to die in the human world. A world she has almost no knowledge of, and no hope of surviving. Conall, finding a woman bloodied, abused, and half dead on his lands, takes her to his keep to nurse her back to health. But she is more than she seems, and he finds himself with far more than he bargained for. Will Cara be able to find lasting happiness after her brother's betrayal, or will pain forever light her path? **This is my NaNoWriMo project, and I'll be posting it as I go. It is a first draft. Any comments or feedback greatly appreciated.** NaNoWriMo15
Boys of the Dark | ✓ (2015) by 3pointt14
31 parts Complete
[ This story was written in less than 30 Days - Winner of November NaNoWriMo project ] Delilah Rose (the actual Devil from actual Hell) sucks at keeping relationships afloat. In desperate attempt to win the heart back of Ryland Woods, a moody, teenage boy from Earth who dumped her ugly persona in the first place, the Devil forms into a seventeen-year-old girl and crashes back to his planet in hope to make him fall in love with her one more time--but for a greater reason than lust. Try measuring the stakes on a universe-saving scale. A comedy where a spirit, hell-ish world meets teenage angst and first world problems. cover by @naramatilda +++ Don't be afraid of us: the Boys of the Dark. We own hearts that starve in the shadows, and soak in the filth of our past. We wear hollowed boned smiles and burn everything to make the warmth last. Ever since you left, its always cold in the dark.
Blood Memories [Last of Elves book 1] (NaNoWriMo 2014) by WolfWynd
62 parts Complete
[NaNoWriMo 2014; Wattys 2014] WARNING. THIS IS A VERY ROUGH, FIRST DRAFT AND HAS NOT BEEN EDITED AT ALL. The land of Elseer has steadily been dying. With only the words of a long-forgotten prophecy to guide them, speaking of both destruction and renewal, the lives of the people hang in the balance, resting all on a single person. Hidden and on the run, he has never settled in one place for more than a few weeks. He is elusive, and mysterious, not the one she thought she would meet in the streets of the busiest city in Elseer. Certainly not the one that the goddess is driving her towards. Last of Elves Book 1 #216 Adventure!
This World is WEird huh? (Book 1) by MonMon465897
9 parts Ongoing Mature
Ever wonder how what it is like to be a hero...well most people do but never are given the chances right...well just give this book a read into this dark magical word... ⚠️ IF YOU CANNOT HANDLE DARK HUMOR PLEASE DO NOT READ THE FOLLOWING CONTENT. The said jokes might not be good but at the same time I do not mean to offend anyone these are and will only be proceeded as JOKES. If you do not have the heart for these joke, please click away and have a blessed day⚠️
The Promised by ClarityNMercy
17 parts Complete Mature
Book One in the Bound by Fate Series: Alice doesn't remember much from her childhood. What she does remember, is that her entire life she's known things, seen things, and heard things that others cannot. Labeled as crazy by those around her, Alice can't help but keep people at arm's length. That is until someone comes into her life that won't take no for an answer. Now, an evil group hell-bent on bringing on the apocalypse, have set their sights on Alice and her brother Max. Will they escape their evil clutches with their lives or will they be sacrificed to Satan himself? *This was my NaNoWriMo 2018 project
The Way of All Flesh by micmaelstrom
14 parts Complete
After her village is destroyed by a powerful daemon, young Naomi sets off on a journey of revenge. Along the way, she meets and befriends fellow travelers, all of whom hide a great darkness in their hearts. Together the group ventures through the kingdom of Cantien and grow slowly closer together and closer to their goal. Accomplishing the impossible, killing a daemon. This story was written for Nanowrimo 2021. It has not been edited nor beta read therefore it is most likely filled with grammar and spelling mistakes, my apologies in advance. This story is also incomplete and most likely will never be completed since I lost the document that had the plot outline on it. But if someone really wants me to finish it I will, I just don't have the time right now. The second half of this story was written after I was in a bus crash and had whiplash so... be nice
Once Upon A Nightmare by xoxo_nara
42 parts Complete
What happens when all the wicked villains from your favorite childhood fairy-tale stories combine their powers to create a new world? A world where the heroes forget who they are. A world where they live as average teens, while the villains ruin their life. A world where the good doesn't always win. A world where fairy-tales no longer exist. With a single sentence, everything can change. All it takes is one single word and the villains can win the game. But no game is fun unless the opponent is playing. Ⓒ All rights reserved 2017 Began Writing November 1, 2017; Completed December 12, 2017; Editing completed December 14, 2017
Codex Gigas - Realm of Serpent God by Luciasher
19 parts Ongoing
In the aftermath of the collision, where the Light Dimension and Dark Dimension violently merged, Arcanoa was born-a realm where fantasy came alive, and nightmares roamed the earth. This cataclysmic event has unleashed monstrous beings from the Hollow Zone, Veilos, upon an unsuspecting world. To balance this surge of darkness, a select few were gifted with the power of Aura-a rare mystical force that grants its bearers the strength to be humanity's guardian. Sixteen-year-old Lucius Gregory has long severed his ties with the unjust world, choosing a life of isolation deep within the whispering forests, seeking solace with his beloved sister, Evangeline. Haunted by a past marred by tragedy, Lucius has forsaken the burdens of destiny and yearn only for peaceful life. But peace is but a fleeting dream. One fateful night, their sanctuary is shattered by the ruthless Chaos Syndicate-a malevolent organization bent on uncovering the domain of the Serpent God with Lucius' power, as foretold by a dark prophecy. Forced to flee, Lucius narrowly escapes the clutches of death, but at the heart-wrenching cost of Evangeline's life. He later discover that the Chaos Syndicate orchestrated the calamity that decimated his village two years prior. They seek the Codex Gigas, a legendary tome said to hold the Answers to All Mysteries within Arcanoa. The first key to unlocking its secrets lies within the cursed power of the Serpent God-power that Lucius inadvertently related to. Driven by vengeance and duty, Lucius sets forth on a perilous quest. Accompanied by his ethereal spirit companion, Lily, and the Exorcists of the Golden Arslan-a revered organization dedicated to restoring humanity's hope, Lucius embarks on a journey across treacherous seas to the Realm of the Serpent God, nestled within the heart of the dreaded Sea of Devils. Will he rise as the beacon of hope his sister believed in, or will he unleash the very darkness he strives to destroy?
Unnatural Instinct: Fallen by smashfiction
31 parts Complete Mature
On angel wings he hauls you into hell where his master waits. Can you escape their clutches? Or will you lose your soul to the flames? You're a normal person living an ordinary life until you're abruptly dragged into hell by a bunch of 'dark' angels. Amid the fires, you discover that you're not normal at all. What's more, the most evil figure imaginable-Satan himself-knows it too. Stuck in a battle that's been raging for thousands of years, you fight desperately to save yourself and the world from Satan's grasp. He wants you. He <em>needs</em> you. He'll do anything to have you. And to your horror, you discover that you desire him just as much. Born as his chosen 'vessel', you find it impossible to resist his charms-until you receive help, and love, from an unlikely ally. Nobody can see God's plan, particularly when it's thousands of years in the making. Note: high erotic content and rape scenes. Part 3 of the Unnatural Instinct Series: the hard and fast, wacky and naughty sexual encounters between humans and their monstrous or magical lovers.
You may also like
Slide 1 of 9
Faith is Fallen (Broken Fantasies Series) cover
Boys of the Dark | ✓ (2015) cover
Blood Memories [Last of Elves book 1] (NaNoWriMo 2014) cover
This World is WEird huh? (Book 1) cover
The Promised cover
The Way of All Flesh cover
Once Upon A Nightmare cover
Codex Gigas - Realm of Serpent God cover
Unnatural Instinct: Fallen cover

Faith is Fallen (Broken Fantasies Series)

65 parts Complete

Some fantasies aren't all they're cracked up to be... Cara, princess of the Seelie Fae, had always been meant for great things. Then, she is betrayed by her brother, and left to die in the human world. A world she has almost no knowledge of, and no hope of surviving. Conall, finding a woman bloodied, abused, and half dead on his lands, takes her to his keep to nurse her back to health. But she is more than she seems, and he finds himself with far more than he bargained for. Will Cara be able to find lasting happiness after her brother's betrayal, or will pain forever light her path? **This is my NaNoWriMo project, and I'll be posting it as I go. It is a first draft. Any comments or feedback greatly appreciated.** NaNoWriMo15

More details