Story cover for Is This Possible? by CheesyDreamers
Is This Possible?
CheesyDreamers
  • WpView
    Membaca 578
  • WpVote
    Vote 48
  • WpPart
    Bab 6
  • WpHistory
    Durasi 44m
  • WpView
    Membaca 578
  • WpVote
    Vote 48
  • WpPart
    Bab 6
  • WpHistory
    Durasi 44m
CheesyDreamers
Bersambung, Awal publikasi Mei 25, 2014
abusealivebrothercomedyconfusiondeaddeathdramafamilyfantasyheavenhellkisslovemysteryromancesuicideweird
She died yet she's still alive.

Is this possible?

Join Dani as she enters a whole different world from her own and she's accompanied by a devil, an angel, cupid and the ones she holds dear. And the latter might include a man she swore to stay away from.

 But her situation has completely changed so is it that bad to stay away from a man who could help her answer questions that she could never in her life conjure up?

     
©Juice Boxes 
All rights reserved.

{cover by @AyeshaHoran}

[Two Thousand and Fourteen]
Seluruh Hak Cipta Dilindungi Undang-Undang
abusealivebrothercomedyconfusiondeaddeathdramafamilyfantasyheavenhellkisslovemysteryromancesuicideweird
Daftar isi

6 bab

Daftar untuk menambahkan Is This Possible? ke perpustakaan kamu dan menerima pembaruan
atau
Panduan Muatan
anda mungkin juga menyukai
{ #3 } Twisted Moon (MxM || 18+) oleh Snape75
94 bab Lengkap Dewasa
Black Moon Series Book #3 Warning: #Mature #Gay #Triggering You shouldn't read this story before you have read at least I Would Give Him The Moon as you'll be missing part of the plot otherwise. My name is Camden and my friends categorize me as a sadist. A sadistic Dominant. I need to get this anger within out and I do so by inflicting mental and physical pain to my Submissives. And yet the moment I get the best kicks is through the aftercare I dispense. My soul is twisted. My past is twisted. * My name is Noah. I'm a homeless teenager who ran away from a homophobic family who never loved me because of what I supposedly did to my twin sister. I need pain to soothe my troubled mind. So I self-harm. My soul is twisted. My past is twisted. "A lifetime of consumption, They've all become the same, I punish them for pleasure, And pleasure some with pain. I punish you with pleasure, And pleasure you with pain" Thirty Seconds To Mars - End Of All Days "I wanna hide the truth I wanna shelter you But with the beast inside There's nowhere we can hide [...] When you feel my heat Look into my eyes It's where my demons hide It's where my demons hide Don't get too close It's dark inside It's where my demons hide It's where my demons hide" Imagine Dragons - Demons
Craving Purity oleh thriving-13
34 bab Lengkap Dewasa
Book I in the Seven Sins Series Greyson and Elijah, two of the Seven Deadly Sins. They got lucky, as they were soulmates and didn't have to search the country or even the world for their spiritually intertwined soulmate. However, even with the connection the two shared, they always felt that something was missing from their shared lives, but they didn't know what it was. That was, until twenty three year old Levi entered Greyson's jeweler store and the two sins immediately felt drawn to him. They could see his purity, but they also sensed a dark past and pain in his heart. The two crave the purity of their soulmate, but they must learn how to embrace their broken love and put him back together. book cover done by @ishanwadhwa123 !!!!
A Perfect Mess oleh athenarowena
17 bab Lengkap
When she thought she found true love and could live happily ever after, everything crumbled to pieces when she lost him in an accident. She never wanted the chance to love again. Her life became a mess; she became a mess. Years later and her life was still as miserable as it is, a job at a cheap club as a waitress-add the teenage drunkards-didn't help at all. She's lost her self-confidence and felt unworthy of herself until a man steps beside her, making her go insane. A man she thought she would never see again. And just like that, everything became a mess. A perfect mess. ********* This story is currently published on webnovel and wp only with the title: Perfect Mess
House Of The Fallen oleh Inmate_Fishyy
32 bab Lengkap
Since Analiese's mother died she's been tossed around like baggage, wondering why her life has to be this way. The day she was pulled away from her mother's dead body haunts her sleep. When she meets Lucifer, a strong, rude, mysterious and beautiful person, everything changes. It changes because she finds out who she really is and what she is really worth to the world and to a certain black haired, golden eyed Lucifer. Is it for the best that Lucifer and Analiese are thrown into each other's lives? You decide. This is a story of forbidden love. The kind of love that breaks hearts, the kind of love that moves mountains. The kind of love that alters the course of heaven and hell? >||Disclaimer: This story has some mature content, but if you know what sex is and won't go completely crazy because of a couple of details then you should be fine.||<
|Hɪs Dᴀʀᴋ Oʙsᴇssɪᴏɴ ||18+ oleh writer_in_delusion
39 bab Bersambung Dewasa
╔═════ஜ۩۞۩ஜ═════╗ Lᴏᴠᴇ & Oʙsᴇssɪᴏɴ sᴇʀɪᴇs ʙᴏᴏᴋ ᴏɴᴇ ╚═════ஜ۩۞۩ஜ═════╝ Dᴀʀᴋ Rᴏᴍᴀɴᴄe ══════◄••❀••►══════ "What made you come here, little cat?" He spoke, Not a question but a demand, point out the hidden sarcasm. His voice husky, and eyes darken. While he Sat On dark couch calmly, Staring at my quivering soul, and all I was In front of the devil, Preparing myself for his meal. "I-I Came to apologize for my earlier mista--" barely audible, with the stammering tone I managed to answer but all he could do interrupt. "On your knees" he Command, and my eyes widen in terror. I looked at him and his ocean blue eyes with a threaten warning was already stucked on me. "Uhmm..w-why?" I questioned, in horror. "Obey me" he spoke with low and menacing tone, after thinking for few seconds which felt for hours in loud silence, I was on my knees. Looking at the 'devil' for next command. And A Smirk, curled up on his lips. "Unbuckle My Belt" He demand, while all I look at him in shock, is he going to hit Me? "W-why?" Again, I questioned with a helpless tone. "You're going to swallow My cock, in your mouth with your eyes on Me. And then i will think to forgive you or not, little cat." And I gulp the large saliva down from the throat just thinking about it. ══════◄••❀••►══════ Where death lies, the Leviathan Hart mention. Fall in love but more like suffocation. Luna stewart, a beautiful shaped soul. Trapped in the world of his dark obsession. ══════◄••❀••►══════ Trigger warning- mature scenes, foil language and torture inside this book. If you are mentally not prepared, this book is not for you. ~Aria. With love for all of you.
Heavenly Sin (EDITING) oleh IMAWRITESSS
33 bab Lengkap Dewasa
"I could kill you," he grins holding the gun to my temple. "I wouldn't be scared," I reminded him. He trails the gun under my chin lifting it, allowing me to look him in the eyes. "No one would know you were murdered by me," he continues making me smile. "I think I might have a gun kink;" I tell him while holding eye contact. "Fuck," he mutters as he smashes his lip onto mine, •••• The crimson colour pools beneath me as I let him twist the dagger that had been living in my heart since the day we had met. Sometimes we settle for the love we think we deserve only because are parents didn't portray it better therefore we think the bare minimum is over the top. ••••
Boundaries of Obsession oleh am12ma34
70 bab Bersambung
His eyes told how dark his thoughts were, what devilish aura he shadowed if she accepted him and was ready to listen to him no one could imagine his doings. She only seeks solitude, but he seeks her, and he craves her as if his life depended on her. He is the cause of her pain. She only wishes to go away from all the emotions, but he can never let that happen. He can show his tears to her, but can she wipe them? Maybe God wanted to create an unforgettable story. His aura screams power that no one can deny except bowing. Her soul reflects others' sins for what others fear to acknowledge. Did she hate him for giving her pain? No, she never hated him. She changed herself.. but what change? She loves him! Maybe not... then what changed...? Love, why is it so difficult either to gain or to lose... "I don't like it when you think about things other than me," he said Is this the start of his madness, or is he already drowned in insanity? She is his heart.........She is the eternal echo God cast into existence for his life. ●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●● He is taking every step near to her, his deep dark eyes looking at her serene, calm face... she is looking directly into his deep, dark ebony eyes... she can clearly see the insanity in his eyes... "Sweetheart, I told you not to think about other things.... but why would you like to provoke me... ha, " his voice is deadly low, sending an electrifying jolt. She is just standing in front of him looking into his sinister soul... He touched her cheek gently, rubbing the soft, gentle, dried tear marks.. He kissed her forehead... she closed her eyes, accepting her fate from which she tried to run away.... "Tell me, sweetheart, what punishment should I give him." A dark mysterious smirk playing on his handsome face... "He is your sister's soon to be husband," she said as he didn't know. He chuckled, a mocking, sinister, extremely insane smile
Red As Snow...(BWAM, Yakuza Romance, 18+) oleh Rachael_Abeauty
48 bab Lengkap Dewasa
"Growing up, my mother always told me one thing; bad company corrupted good morals. I didn't believe her, didn't believe those words she'd always said to me with such conviction. I'd always thought myself strong, always thought myself good enough to corrupt those bad morals. That was until I crossed paths with a man so lethal, a man so utterly consumed with darkness. And gradually, his words of poison would lace my system, dilute my sanity and leave me begging at his feet for more..." It was hate at first sight... I DO NOT OWN ANY OF THE IMAGES USED IN THIS BOOK. ALL CONTENT WITHIN THIS BOOK IS FICTIONAL AND WORKS OF MY IMAGINATION. ANY SIMILARITIES TO REAL-LIFE EVENTS, PLACES, PEOPLE etc IS PURELY COINCIDENTAL. MY BOOK IS NOT FOR PUBLIC DOMAIN. ALL RIGHTS RESERVED. COPYRIGHT ©️ 2023 by Rachael Abeauty! THIS BOOK CONTAINS MATURE CONTENT; DARK ROMANCE, SEXUAL SCENES, STRONG LANGUAGE, SELF-HARM, etc. BOOK COVER MADE BY ME, THE AUTHOR.
Our hearts are a black hole oleh klyiaa5971
27 bab Lengkap Dewasa
*WARNING: CONTAINS TALK ABOUT SUICIDE AND MENTAL HEALTH PROBLEMS ALONG WITH SELF HARM! DO NOT READ IF THESE ARE TRIGGERS! somewhat based off the book "My heart and other black holes" Dan is planning on committing suicide,because o what his mother has done,but doesn't want to do it alone,so he gets on a website called,'Till death do us apart' where you find a stranger that lives around you who also want to commit suicide.Where he meets Phil,they meet up one day,but over the days they talk,they slowly fall in love.
anda mungkin juga menyukai
Slide 1 of 9
{ #3 } Twisted Moon (MxM || 18+) cover
Craving Purity cover
A Perfect Mess cover
House Of The Fallen cover
|Hɪs Dᴀʀᴋ Oʙsᴇssɪᴏɴ ||18+ cover
Heavenly Sin (EDITING) cover
Boundaries of Obsession cover
Red As Snow...(BWAM, Yakuza Romance, 18+) cover
Our hearts are a black hole cover

{ #3 } Twisted Moon (MxM || 18+)

94 bab Lengkap Dewasa

Black Moon Series Book #3 Warning: #Mature #Gay #Triggering You shouldn't read this story before you have read at least I Would Give Him The Moon as you'll be missing part of the plot otherwise. My name is Camden and my friends categorize me as a sadist. A sadistic Dominant. I need to get this anger within out and I do so by inflicting mental and physical pain to my Submissives. And yet the moment I get the best kicks is through the aftercare I dispense. My soul is twisted. My past is twisted. * My name is Noah. I'm a homeless teenager who ran away from a homophobic family who never loved me because of what I supposedly did to my twin sister. I need pain to soothe my troubled mind. So I self-harm. My soul is twisted. My past is twisted. "A lifetime of consumption, They've all become the same, I punish them for pleasure, And pleasure some with pain. I punish you with pleasure, And pleasure you with pain" Thirty Seconds To Mars - End Of All Days "I wanna hide the truth I wanna shelter you But with the beast inside There's nowhere we can hide [...] When you feel my heat Look into my eyes It's where my demons hide It's where my demons hide Don't get too close It's dark inside It's where my demons hide It's where my demons hide" Imagine Dragons - Demons

Detail lengkap