sneak preview of: Lust and Desires That's Our Fate
HeavenlyRefuge
  • Reads 31
  • Votes 0
  • Parts 3
  • Time <5 mins
  • Reads 31
  • Votes 0
  • Parts 3
  • Time <5 mins
HeavenlyRefuge
Ongoing, First published May 26, 2014
badboysbadgirldesiresfategirlhighschoollovesneakpreviewteeagersteenfiction
Will the both of them ended up together or It's their fate that only Lust and Desires hold between them.  This is just a sneak and peak preview for my upcoming book and that it won't be in sequence. Hope you all will enjoy.
All Rights Reserved
badboysbadgirldesiresfategirlhighschoollovesneakpreviewteeagersteenfiction
Table of contents

3 parts

Sign up to add sneak preview of: Lust and Desires That's Our Fate to your library and receive updates
or
#946badboys
Content Guidelines