Purple Adventures [1ST DRAFT/BEING REWRITTEN]
ABetaO
  • Membaca 1,501
  • Suara 60
  • Bagian 17
  • Durasi 3h 14m
  • Membaca 1,501
  • Suara 60
  • Bagian 17
  • Durasi 3h 14m
ABetaO
Lengkap, Awal publikasi Feb 15, 2019
acceptanceadventureanxietycollegecomedycommunitydramaepilepsyepilepsyawarenessfriendshipfunnygreekmythologygrievinghumorhumourlgbtnonbinaryownvoicespanicattackssudepteenfictionuniversityyoungadult
A story of young adults befriending one another & getting through life together. Sounds pretty average but nothing is ever simple, especially in a purple world.

Maia has epilepsy & that alone makes life hard in so many ways. This also means that being the new girl at a close-nit university isn't at the top of her list of worries. Don't underestimate Maia though. This young woman may be shy & disabled but she's strong & knows how to live life at times, even if it sometimes lands her in some hot tea.
Eros doesn't share Maia's diagnosis but he has his own unpleasant experience with the nasty brain disorder. While he's quite confident & sure of everything, his past has thrown him off track & tends to make him quite stand offish. Sometimes the wrong track leads to the most fun though.
What about Nereus you ask? Well they've been Eros' support system for quite some time but they're known for their truthfulness & virtue which always brings some brutal humour to any situation. Everyone has to decide whether they actually like the truth or not when it comes to Nereus.

Add these people, their contrasting personalities & their complex histories to the same close-nit neighbourhood & university & you're bound to have some purple adventures awaiting you.

Content Warning: mention of SUDEP throughout story, detailed descriptions of panic attacks will be included but not frequently, detailed first person description of semi aware convulsive seizures (can feel and hear during episode) will be included but not frequently.
Please read with caution if any of this is likely to be uncomfortable or triggering. If you message me I'm happy to make sure you're aware of where such content will be placed and in which chapter.

This is an #OwnVoices book.
Seluruh Hak Cipta Dilindungi Undang-Undang
acceptanceadventureanxietycollegecomedycommunitydramaepilepsyepilepsyawarenessfriendshipfunnygreekmythologygrievinghumorhumourlgbtnonbinaryownvoicespanicattackssudepteenfictionuniversityyoungadult
Daftar isi

17 bab

Daftar untuk menambahkan Purple Adventures [1ST DRAFT/BEING REWRITTEN] ke perpustakaan Anda dan menerima pembaruan
or
#358grieving
Panduan Muatan
anda mungkin juga menyukai
Family Comes First oleh CRAZY40429
80 Bagian Lengkap Dewasa
Being alone? Check. Being afraid? Check. Being abused? Check times 3. Honestly, my life wasn't this bad before, not until I ended in foster care... SIKE! My life was always bad. From the moment I was born, I lived with an abusive father who blamed me for my mother's death, and even I couldn't disagree with him. Here are a few questions I am constantly asked: 'Do I do well in school?' No, are you kidding me? The only subject I'm good at is Visual Arts. 'Do I have a kind and caring family?' No, I don't think I do. 'Do I have anyone who cares about me?' No, I'm a loner and socially awkward. 'Do I have privileges?' No, if you haven't understood the message yet, I live in an abusive household. Now, you might ask if there are any questions the answer is yes. I'll give you some. 'Do I want to die?' Yes, I sometimes do. 'Do I feel alone in this world?' Yes, always. 'Do I get a beating every day?' Yes. *** This is Amara Williams, a 13 year-old with average grades and no friends. What happens when her only guardian, her dad, is dead? What happens when she finds out that she has five older brothers who are not only strict and demanding, but also protective assholes? More importantly, what happens when she finds out that she was taught lies from the moment she was born? Follow Amara as she digs deeper into her family history, uncovering the secrets and discovering the lies. ___ ⚠️ Trigger Warning ⚠️ There will be mentions of abuse, r@pe, self harm, death, and many other dark themes. I have given a warning now, and I will give a TW in each chapter when reading for safety reasons. However, I want all of my readers to know what to expect so that they can decided for themselves if they want to read. Read at your own discretion! ____ Highest Rankings: #1 in Rules: Oct. 18. 2020 #1 in Truth: Jan. 16. 2021 #1 in Alcohol: Jun. 18. 2021
Bad Girl's Nerd oleh _angry_human_
55 Bagian Lengkap Dewasa
"To what do I owe this honor?" his voice is trembling with laughter. Jee-buss... he finds this funny... "I saw a butterfly and followed it in here?" I more like ask. He starts laughing. I can only stare. I am loving this. I love this sound. I love this clear view of his forest-green eyes without any glasses. He puts his head on my shoulder as he continues to laugh. "Oh dear, is that what it would take me to get you in my room?" he wipes his eye releasing my hands. I want to answer, 'No... All you need to do is smile and I'll follow you anywhere'. But I keep my mouth shut. He is looking down at me. "Seriously, why are you here? Tell me before I start assuming...." he raises his eyebrow suggestively. ........................................ Read the hilarious and romantic adventure of Luke Wright and Natalia Anderson, as they deal with their own devils and friends all the while getting tangled in their feelings. [[!!Due to wattpad glitches my book might be shown as 'Public Domain' or 'CC'. This book strictly belongs to me and the rights are reserved duffus.. So do not copy my book or story!!]]
His Little Flower (18+) (Completed) oleh KtDark7
16 Bagian Lengkap Dewasa
*Dark Short Story with triggers including abuse/torture and violence, sexual assault, stalking and home invasion* Someone has been been following me. I never see a face or catch a glance of a shadow but I know somethings not quite right. My life changes forever when I arrive home one day to a nightmare. Just when things seem to be looking up he comes back for me, and this time he wants me for more than just one night. ------ Please note: This is a fictional story. Many, if not the vast majority, of the actions taken by the fictional characters are absolutely not ok in real world, non-fictional settings. This is a dark short story that contains triggers and themes such as kidnapping, graphic sexual assault/ sexual objectification, drugging and abuse/torture. DO NOT continue if you don't enjoy reading that sort of thing in fictional worlds. ------ #1 in: HomeInvasion (January 2024) MatureAudience (January 2024) Heldcaptive (January 2024) Captor (January 2024) #2 in Dark (April 2024) #3 in Force (April 2024) #5 in Force (January 2024) ------ Below are some crisis and help hotlines (US numbers) Suicide, Mental Health Crisis: 988 National Human Trafficking Hotline: 1 888 373 7888 National Domestic Violence Hotline: 1 800 799 7233 Emergency Services: 911
Icarus oleh lola-n
40 Bagian Lengkap Dewasa
Summary: This story is about an incredible unique autistic girl and her two equally incredible best friends. Will they ever get out of the friend zone? A little taste of the story: Is it a sin to love someone too much? To say I miss her is an understatement. I can't eat. Can't sleep. Can't function. She is constantly on my mind as she dwelled herself deep inside my heart. My heart aches for her. Every time I think of her, I smile but my heart hurts like hell because she lives far away. Too far. Sometimes all I can do is lie in bed and hope to fall asleep before I fall apart. Is it wrong to love someone this deeply at such an early age? I have inappropriate thoughts about her...about us. Not, as we are presently but grown up as adults. I'm jealous of my twin brother because he wants to take her from me. I can't let go of what's making me sad because its also the only thing that makes me happy. Her. I cannot lose her, because if I do, I will lose my best friend, my smile, my heart, my soul mate, my everything. If it is a sin, I don't think I want to be forgiven because I truly believe that God has sent her into my life to give me something to fight for, to show me there is love in this world, to give me hope and to bring me joy. All the proof I need in God is in her. She is a gift from heaven." ⚠️WARNING ⚠️ * language *drugs & alcohol * violence *assault & rape *nudity & sex
Happy Ending? oleh nevergetrobbed
66 Bagian Lengkap Dewasa
I panickedly walked down the now empty hallway I heard some footsteps behind me I turned around to see the idiot who was NOT my GIRLFRIEND. "Don't follow me," I said loud and kept walking. But that idiot couldn't understand a hint "If you Do not stop following me I swear to the goddess I'm going to hurt you," I turned around to look at her "Look I'm sorry I didn't mean that to happen" "You didn't mean to tell the whole school that we are a couple when I have literally only ever talked to you one time?"I asked angrily. "Well yeah I did mean to do that," She answered with a frown trying to think about what to say. But I didn't give her a chance as I accidentally lifted my foot and hit her hard in between her legs. I felt something as my foot connected with her crotch but I didn't think about it As she fell on the empty hallway. Holding her hand in between her legs While saying something like Goddess and hot. I didn't listen as I walked out of the school hallway and left her there. This book has trigger warnings such as Abuse,BDSM,Strong Language,Mentally Unstable,Health Issues,Sexual, Violence,Addiction,Drugs,Alcoholic,Mention of Child Abuse,Death,Foster-system,Mommy Issues,Daddy Issues, Homophobia, sexist And Racists. If I missed something please tell me so I can put it there. THIS IS FOR 18+ ONLY Stay safe y'all 👋🏾👋🏾 PS, don't forget to vote and comment, I wanna know what y'all think! Cover made by @Nightmare1928
His Shadow (Book I) oleh LokiBoreddd
45 Bagian Lengkap Dewasa
Book I of 𝓣𝓱𝓮 𝓢𝓱𝓪𝓭𝓸𝔀 𝓢𝓮𝓻𝓲𝓮𝓼 After feeling invisible for so long she finally was seen by the one boy that was supposed to be off limits. Little did she know falling for him would be the best and maybe worst thing she could have done in the long run. ***{Sneak Peak ONE}*** "Aurora, I don't want you back in my house if you are willing to act this way. You are no longer my child, I don't know who you are or what you have done with my daughter but you aren't her." My eyes start to water, great so I am apparently disowned, an ungrateful peace of shit and i'm not good enough for anyone. ***{Sneak Peak TWO}*** I look over at the door to see Juliano opening it. He walks over to me and says, "So we might have a slight problem." I look at him in confusion as he continues speaking, "Do you remember Lucian Kingston?" I nod. Of course I remember that creep. "Well he had something to do with your car accident." *** 𝓐𝓾𝓻𝓸𝓻𝓪 𝓑𝓵𝓪𝓴𝓮, 17, the girl that's always in her brothers shadow. The sweet, loving, smart girl who only gets the bare minimum and acts like she is completely fine. The beautiful brunette that falls for the Wide receiver on the football team thats also her brothers best friend. 𝓙𝓾𝓵𝓲𝓪𝓷𝓸 𝓒𝓸𝓼𝓽𝓮𝓵𝓵𝓸, 19, the boy that basically had it all but a relationship, party's all the time with Ashton Blake, plays football, an overprotective pain in the ass, ends up falling for the one girl that he shouldn't have. When will Aurora finally be able to shine? Why is Aurora in her brothers shadow? What will happen in the end? Read to find out!! |trigger warning| mentions of Self harm, Suicide, Self doubt, gore, and anxiety. STARTED: April 30, 2023 FINISHED: May 31, 2023 PUBLISHED: July 19, 2023 WRITER GOALS! 1k reads: 07/05/23 5k reads: 12/17/23 10k reads: 6/29/24 20k reads:
Scream oleh DefinitelyKayla
34 Bagian Lengkap
"Freak." Violet called too me. I turned around too see a blinding light hit me in the eye. I fell down violently shaking. ~∞~∞~ Meet Winter Neveah Hope Claser, A 13 year old girl that has epilepsy and has gone to school for one day in her whole life, and that day she encountered the 3V's, Veronica, Valerie, and Violet. The day she dropped out, she thought she was never going to see them again. She's starting 7th grade at Beach Life Public School. Winter is forced too accept her differences, face the bullies, the problems of a friendship, how to stand up for herself, and the screams. She also has to learn how to deal with her first crush, Noah Garner. _________________________________________________________________ THIS IS MY (@DefinetlyKayla 's) FIRST BOOK
The Heartthrob Won't Leave oleh TheePeaches
60 Bagian Lengkap
Formerly known as "The Heartthrob Won't Leave Me Alone!" - "God Blake, you're a true enigma" Her eyes widened slightly at his words. "I don't understand" she claimed, backing up a step from him, which he had clearly noticed. And to her shock, he took a step forward, blocking the gap she had just created. "You seriously don't see what I was trying to do up there?!" he asked, almost in disbelief. "Do you have any idea how long I've been waiting to do that?!" she couldn't believe how loud he was suddenly. She had always known Lucian as a calm person with a soft, almost brooding voice that he never raised. Now it almost sounded excited, it was interesting seeing a new side of Lucian Black. - Something is happening at Cross Climb High-school Although it seems fairly normal, students going amongst their days unbeknownst to who they travel life beside. Blake Collins was forced to move schools, along with her four best friends. With her mother dead and her father in prison for attempting to murder her brother, she's in foster care, struggling every day with panic attacks and obsessive thoughts from a past of psychological damage. In her new school, she deals with not only her constant daily struggle to maintain normalcy, but also somehow becoming the director of the school play. Add a crush on the school's bad boy, Zac, who seems more interested in Stella, Blake's promiscuous best friend and also contending with another one of the school's popular boys, Lucian, chasing her constantly despite firmly keeping up her barriers. Everything seems fairly normal, at least at first. But, brewing nearby is a rage so intense that it's about to bubble over, and when strange things start happening around her, Blake can't help but fear the worst events will unfold and hope that it won't take the lives of those she loves along with her own. Be careful, because you never know what people are really thinking. - *Warning* Swear words, violence and thought of self harm
Tomorrow's Blues oleh fadedxfires
47 Bagian Lengkap
~"You don't- you don't need me." I stared in shock. This was the first shred of emotion he'd shown since he started avoiding me, and I had no idea how to respond. What was I supposed to say to something like that? So I let myself be honest, and I told him exactly how I felt. "But I do." I almost choked on my words. "I do need you. I can't talk to anybody else. I can't eat. I can't sleep. And I know you know what that's like."~ Liliana is now an orphan. Just 17 years old, she lost her parents in a boating accident and now she must live with her best friend, her best friend's parents and her best friend's brother, Joseph. She struggles through her grief as well as dealing with the mysterious but obnoxious Joseph, and it soon comes to light that he isn't the only one around her keeping secrets. Living under the same roof, tensions arise, and Liliana begins to discover that a perfect family may not be so perfect after all." If you like a good old slowburn, enemies (ish) to lovers, bonding over tragic backstories type beat then this story is for you, I promise :) #1 in #bestfriendsbrother (didn't note the exact date - some time in January 2021) #1 in #dealing with death (11/04/21) amazing cover by @sixty6ix !!
The Miracle of a Teenage Romance oleh Bravesgurl
27 Bagian Sedang dalam proses
Caden grabs both of Lilly's hands, pulls them close to him, and says, "Lilly, please stop saying that. It's not your fault Caleb's a jerk who likes to fight and I can't find any better of a friend than you. Do you know why?" Lilly shakes her head in confusion and Caden continues, "Because Lilly, the truth is...you are the greatest friend I have ever had. I am so glad I met you and ran after you yesterday. In fact, if it wasn't for me meeting you yesterday and hanging out with you, I most likely wouldn't be here right now." Confused, Lilly asks, "Wh-what do you mean you most likely wouldn't be here? Where would you be?" Caden replies, "Gone." Lilly questions, "Gone? Caden, what do you mean gone?" ************************** Lilly's life is good, she has God, her family, friends, and cheerleading to get her through life. However, one day, things start to change. Her friends start to pull away, the new boy at school, Caden, begins showing interest in her and on top of all that she starts having dizzy spells, sometimes so bad it almost makes her faint. Lilly's life is changing, and changing fast. What will happen next? WARNING: There is very mild cussing in the first few chapters! If u don't like that fact, I'm sorry. I don't either but it's mean girls in high school and I don't know what else they would say. Disclaimer: I do not own any of the pictures used in this story. Also, shoutout to my bestie, @AlwaysAndForever0V for helping me with this blurb. P.S. Please comment and vote. That would really mean a lot to me. Enjoy! Also, if you see this story on any other website other than Wattpad or Quotev, please note that that website stole it from me! Therefore, the content may or may not be the same!
anda mungkin juga menyukai
Slide 1 of 10
Family Comes First cover
Bad Girl's Nerd cover
His Little Flower (18+) (Completed) cover
Icarus cover
Happy Ending? cover
His Shadow (Book I) cover
Scream cover
The Heartthrob Won't Leave cover
Tomorrow's Blues cover
The Miracle of a Teenage Romance cover

Family Comes First

80 Bagian Lengkap Dewasa

Being alone? Check. Being afraid? Check. Being abused? Check times 3. Honestly, my life wasn't this bad before, not until I ended in foster care... SIKE! My life was always bad. From the moment I was born, I lived with an abusive father who blamed me for my mother's death, and even I couldn't disagree with him. Here are a few questions I am constantly asked: 'Do I do well in school?' No, are you kidding me? The only subject I'm good at is Visual Arts. 'Do I have a kind and caring family?' No, I don't think I do. 'Do I have anyone who cares about me?' No, I'm a loner and socially awkward. 'Do I have privileges?' No, if you haven't understood the message yet, I live in an abusive household. Now, you might ask if there are any questions the answer is yes. I'll give you some. 'Do I want to die?' Yes, I sometimes do. 'Do I feel alone in this world?' Yes, always. 'Do I get a beating every day?' Yes. *** This is Amara Williams, a 13 year-old with average grades and no friends. What happens when her only guardian, her dad, is dead? What happens when she finds out that she has five older brothers who are not only strict and demanding, but also protective assholes? More importantly, what happens when she finds out that she was taught lies from the moment she was born? Follow Amara as she digs deeper into her family history, uncovering the secrets and discovering the lies. ___ ⚠️ Trigger Warning ⚠️ There will be mentions of abuse, r@pe, self harm, death, and many other dark themes. I have given a warning now, and I will give a TW in each chapter when reading for safety reasons. However, I want all of my readers to know what to expect so that they can decided for themselves if they want to read. Read at your own discretion! ____ Highest Rankings: #1 in Rules: Oct. 18. 2020 #1 in Truth: Jan. 16. 2021 #1 in Alcohol: Jun. 18. 2021

Detail lengkap