Story cover for Just for information by Benie_El
Just for information
Benie_El
  • WpView
    Membaca 144
  • WpVote
    Vote 21
  • WpPart
    Bab 3
  • WpHistory
    Durasi 9m
  • WpView
    Membaca 144
  • WpVote
    Vote 21
  • WpPart
    Bab 3
  • WpHistory
    Durasi 9m
Benie_El
Bersambung, Awal publikasi Mar 02, 2019
antipiracyartbookarticleartistcopyrightdetailsdrawingshelpimaginesinformationpaintingpicturesprotectionsecuresecuritysimplesmilesquadunderstanding
It's all about picture copyrights.
Information about how to copyright your pictures
Domain Publik
antipiracyartbookarticleartistcopyrightdetailsdrawingshelpimaginesinformationpaintingpicturesprotectionsecuresecuritysimplesmilesquadunderstanding
Daftar isi

3 bab

Daftar untuk menambahkan Just for information ke perpustakaan kamu dan menerima pembaruan
atau
#375details
Panduan Muatan
anda mungkin juga menyukai
One Soul In Two Bodies [ONESHOT] oleh Mintiezzz
2 bab Lengkap
You suffer in a tragic love story, where, your athletic lover suffers an unfortunate accident. Think of it like this, you love to paint in favor of your enjoyment. What happens when someone takes all the color in the world? You simply cannot paint anymore. You cannot do what you love as you cannot find love in what you do anymore. Nevertheless, you decide to be there for them. Are you ready to challenge the red strings of fate?
High School Story: University Life (rewritten) oleh proteus912
33 bab Lengkap
.
Manan ss-lost the past. (Completed) oleh gumaank
16 bab Lengkap
....
Self-Destruction oleh Neko_Noelle
84 bab Lengkap Dewasa
Fake a smile, No one knows you're broken. Fake a smile, it's easier than trying to explain why you're sad. Fake a smile, lie and say you're fine, it's easier then trying to explain why you do what you do. Quotes, Stories, Entries and Poems about what it's like to be depressed, alone, suicidal etc...
Not Another Word || Lab Rats One-Shots oleh ShayWritesFanfics
10 bab Lengkap
❝Talking would simply ruin the moment.❞ Full description inside. |Completed One-Shots| |Un-Edited| © 2014-2016 Smilie254 {ShayWritesFanfics}. All rights reserved.
Voltron: The Mysterious Prisioner (Keith X reader) (OG Version) oleh Lidia385
15 bab Lengkap Dewasa
This story has been rewritten. This is the terrible original version. Look for the new one under my works.
UNI'S EPIC ART BOOK oleh Begone_Cupid
139 bab Lengkap
Just an epic art book. All my art from 2018-19 to present. Also, husky memes and glithing dogs along with other news.
Eddie Munson Oneshots oleh iluv2karina
19 bab Bersambung Dewasa
self explanatory, will try to write 100 of these. any requests, email, iiluvkarinaa@gmail.com
The Art of the Valdt oleh ValdtRift
27 bab Lengkap
Whether you want character art and behind the scenes of how I created the world of my stories, or to just look at the drawings I've done in the past, this book has it all! If you enjoyed my story Lily of the Shadows or you want a visual guide before you decide to read my work, this book is for you. And if you are new to the world of my stories, welcome! This guide should help you learn. Thanks for reading.
anda mungkin juga menyukai
Slide 1 of 9
One Soul In Two Bodies [ONESHOT] cover
High School Story: University Life (rewritten) cover
Manan ss-lost the past. (Completed) cover
Self-Destruction cover
Not Another Word || Lab Rats One-Shots cover
Voltron: The Mysterious Prisioner (Keith X reader) (OG Version) cover
UNI'S EPIC ART BOOK cover
Eddie Munson Oneshots cover
The Art of the Valdt cover

One Soul In Two Bodies [ONESHOT]

2 bab Lengkap

You suffer in a tragic love story, where, your athletic lover suffers an unfortunate accident. Think of it like this, you love to paint in favor of your enjoyment. What happens when someone takes all the color in the world? You simply cannot paint anymore. You cannot do what you love as you cannot find love in what you do anymore. Nevertheless, you decide to be there for them. Are you ready to challenge the red strings of fate?

Detail lengkap