Glory and Empire
grandmobiusbrian
  • Reads 391,711
  • Votes 4,162
  • Parts 28
  • Time 7h 1m
  • Reads 391,711
  • Votes 4,162
  • Parts 28
  • Time 7h 1m
grandmobiusbrian
Complete, First published Aug 02, 2012
admiralsagronbattlesdesertdrauldreadnoughtempirefallfictionfleetsgannerhyperspacekendahlmurdermysteryparanormalpearsonportalsalabastsciencespacestarterrantimetravel
The Terran Empire is in a state of chaos after the successful sack by the Valdi armada.  As the Terran fleets struggle to reorganize, First Marshal Scott Pearson led the charge to cut into the enemy flank and stem the tide of reinforcements.  With Orion help, he was succeeding, until Captain Traci Ganner interfered--again.
  
But Traci must bring the Terran marshal and the chief Orion councilor together to confront a new Terran threat from the future.  Facing daunting new technology, Traci finds herself in the clutches of a new Terran enemy and if they force the location of the rift from her, both the Terrans and Orions will be lost.

In the final book of the Traci Ganner trilogy, Traci and her officers must endure their most difficult trials yet that leads Traci to a mystical temple that holds the keys to her very survival.
All Rights Reserved
admiralsagronbattlesdesertdrauldreadnoughtempirefallfictionfleetsgannerhyperspacekendahlmurdermysteryparanormalpearsonportalsalabastsciencespacestarterrantimetravel
Table of contents

28 parts

Sign up to add Glory and Empire to your library and receive updates
or
#166desert
Content Guidelines
You may also like
Fall of the Terran Empire - Traci Ganner series book 1 by grandmobiusbrian
21 parts Complete
Resisting the cruel, conquering machine of the mighty Terran Empire, the Orion Star Cluster locks its fledgling navy in combat with one of the most brilliant Terran admirals in its history. But Orion's only chance rests with a discovery made by a young imperial cruiser commander named Traci Ganner. In a routine Pirate patrol, Ganner discovers a new world defended by Strike Fighters; a technology neither the Terran Empire nor Orion Clans possess. In a bid to save them both, Ganner devises a cunning plan, a plan that will come with a terrible price. To succeed, she must secretly unleash an unthinkable force and continue to stay one step ahead of everyone until it is time to reveal the truth. She is pitted in a game of wits against the highest levels of Imperial Command, including the Emperor himself, in order to save her own life, and those she cares for.
Descendants of Rome (#3 in Gladiator Series) by milly_king818
60 parts Complete
Nearly two decades have passed since Krista and her band of gladiators won their freedom, but the empire is far from peaceful. The Colosseum still remains and with their escape scarring Rome's history, the emperor's hunger for power has never been greater. Extinguishing all attempts at rebellion, it is only a matter of time before the enslaved people of Gallia take a stand against their tormentors. Fearing another slave rebellion, the Emperor Trajan orders the legions of Rome to march on Gallia. * * * Born to two gladiator parents, Lazarus's dreams are filled with following in their footsteps and fighting upon the sands of the arena. With his trusted friend by his side, Lazarus will make the journey to Rome only to find his future of glory thrown into turmoil. The arrival of his parents in Rome has set off a chain of events that will test Lazarus's bravery and skills to the limit. With a new young commander threatening his loved ones, Lazarus must choose between a life of glory and a life of freedom. And with everything not being what it seems, can Lazarus make his parents proud or will he die trying? _________________________________________________________ Non est ad astra mollis e terris via. There is no easy way from the earth to the stars. __________________________________________________________ Book 3 of the Gladiator series. All Rights Reserved. Photos belong to their original owners.
HSC Battlecruiser Series Book 2 "Planet 2110" by rustyconner
14 parts Complete
The story continues on the vessel HSC Battlecruiser. The crew discovered that they had an alien onboard their ship. This was no ordinary alien. It had abilities beyond any normal alien. It could teleport itself to any place it wanted to. The General had ordered Officer Barker to keep her a secret, but with the discovery of the Captain and Sr. Officer Victoria Vine, she was discovered. The Captain had a conference with his Sr. Officers to discuss sending her back home. In the middle of the meeting Arian, the alien spoke up. She told the crew that her planet was in danger by a dangerous foe, the Regits. These aliens were to not be messed with since Arians people were a peaceful alien race they didn't believe in fighting. The Captain had stationed Baker and Arian to coordinate everything and get a team assembled to try and free Arian's people. In the middle of this discuss Sr. Officer Katherine Bird spoke up and told the Captain that the Regits are a known enemy to her species the Drapoel. That they were not a race to take lightly. So the Captain assignment Bird, Baker, and Arian to the mission details. Will the crew be able to capture the planet back for Arian's people? Read this book to find out. HSC Battlecruiser Series Book 2 - "Planet 2110" If you're interested in using this story for any Voice Acting or Acting groups please reach out to me on here or on Line ID, my username is Yoda419. Thank you all for the support and I hope you enjoy this book. Book 2 of Series
Terran Oblivion by ELChandler
37 parts Ongoing
In the pulse-pounding sequel to "Stellar Oblivion," chaos reigns as warlord Charles Etienne seizes control of Port Au Prince in a brutal revolutionary coup. With the nation of Haiti teetering on the brink of oblivion, Oblivion Division springs into action to restore order. NATO agents Simon Renolds, Robert Kushner, and Courtney Bernard are thrust into a deadly game of cat and mouse as they fight to restore order in the face of unfathomable danger. But what begins as a mission to save a city soon spirals into a race against time to prevent global catastrophe. As they delve deeper into the heart of darkness, the agents uncover a sinister conspiracy that threatens not just Haiti, but the very existence of humanity itself. With the fate of the world hanging in the balance, can Renolds, Kushner, and Bernard unravel the truth before it's too late? Join them on an adrenaline-fueled journey through treacherous terrain, where betrayal lurks around every corner and the line between friend and foe blurs. In "Terran Oblivion," the stakes have never been higher, and the clock is ticking...
Return From Exile by TheWGO
9 parts Ongoing
The Karadolex Galaxy is a vast, populated expanse featuring numerous livable worlds, diverse species, and various factions, each with its own territory. Ships travel through interdimensional rifts, enabling faster-than-light travel. The story picks up ten years after a long, devastating war between humans, the Seven Worlds of Rhyus, and the Vorcons of the Vorcon Empire. This war encompassed many worlds and resulted in billions of deaths. The Vorcon Empire had been waging war and conquering nearby worlds for years. As the Vorcon threat grew, factions across the Karadolex galaxy pleaded for help from the Seven Worlds of Rhyus. Responding to the crisis, the Seven Worlds deployed their military force, the Rhyus Defense Fleet (RDF), leading to a protracted 20-year conflict that ultimately ended in a peace treaty. Garen Rivers, a general for the RDF, hailed as a hero for his strategy and tactics during the war, commanded the RDF Battle Cruiser, The Riftkin. He protested the peace treaty, believing the Vorcons would rebuild and wage war again. The newly appointed Council of Seven, determined to end the war, dismissed Garen's concerns. Publicly ridiculed, he suddenly found himself alone. Many did not want to associate with him due to his public stance, even though many agreed with him. Standing alone and stripped of his command, Garen resigned and retreated to the remote world of Chiex to live a simple life in the wilderness near a small Camerian settlement. Garen's peace is shattered when his old rival, Vorcon Caul Malocktus, threatens the Camerian settlement. Forced to flee, Garen returns to Rhyus, the capital of the Seven Worlds, where his mentor requests his leadership on a mission. Garen must take a stealth ship into Vorcon territory to assess the threat posed by a new Vorcon weapon. Reuniting with old friends and facing former enemies, Garen discovers that much has changed. He learns that there are more threats to the Seven Worlds than just the Vorcon Empire.
Orion Gambit - Traci Ganner series book 2 by grandmobiusbrian
18 parts Complete
This is the second book in the Traci Ganner series. After her successful campaign as a starship captain (and spy), she had been assigned to Orion's newest cloaking battle cruiser. Now her mission is to make contact with the invading Valdi and negotiate for strike fighter technology. But it won't be easy. Not only do the Valdi have a reason to hate all Terrans, but Traci has her own problems with the Terran Empire, and if they catch her, she will be executed.
Astronomer by Ottabie
22 parts Ongoing
In a dark, war-torn galaxy, where corporations pull the strings of power and the Federation struggles to hold the line against the terrifying forces of aliens, Rhys a seasoned mercenary fights for one thing: Money! Paired with his partner in crime Jax, Rhys takes on missions that keep them just out of the conflict zone. But when a seemingly routine mission sends them directly into the path of the Federation's most mysterious threat, Rhys finds himself caught in a battle much larger than any payday. This story is a prequel to the story of "Astrominer" [2 Chapters Daily]
Waymakers (Champions of the Crystal Book 9) by AnnaIdanBerg
120 parts Ongoing
Five years after the Kyan invasion of Praxatillus nearly succeeded, there is an uneasy feeling in the Realm that the worst of the war lies ahead. With the Guardian and combined Wayship/Praxatillus fleet still missing, Sabrina Devon has been trying to train the Inheritor to defend them all in her mother's absence. But when a massive Kyan troop ship appears in orbit without warning, it seems they have run out of time....
The Tree of Life: Enoch's Children Book 7 by Cyrano00
46 parts Complete
The aliens, the Nimobes, have settled into their city many miles south of Jasper on the open land north of the Grand Canyon. They watch the people in Jasper, and have developed a relationship with them through the doctor that was supposed to spearhead the invasion, but protected the town instead. But hidden in the upper eschelons of their leadership, the war with Earth is about to take a dramatic resurgence, and Mordechai, the Nimobe doctor, is the only one who can stop it. The deadly spiders that the Nimobes waged a constant battle with back on their homeworld, stowed away on their ships and arrived in their new city with an agenda of their own. Cory, Thomas and Virgil visit the great tree, revered by Virgil's people and hidden deep in the caverns he lived in for most of his young life, to see if they can save it. Since the caverns were opened the tree has been slowly dying. They have to recover from the strange oath they've been put under, and return to normal life. But can they do it, or will them remain forever under the control of Wilks and his followers?
TerraWorld~We Are The Broken Ones...(#4) by KevinTheKitsune
21 parts Complete
In the aftermath of a harrowing battle, the world of Terraworld teeters on the brink of darkness. As the dust settles and the echoes of combat fade, a new threat emerges from the shadows, casting a pall of uncertainty over the land. Violett and her companions, weary but resolute, find themselves confronting an enemy unlike any they have faced before. The shadows that once lurked at the edges of their world now surge forth with renewed vigor, their sinister intent shrouded in mystery. As tensions rise and alliances are tested, Violett and her companions must journey into the heart of darkness to confront the source of the shadow's power. Along the way, they will encounter new allies and face unimaginable challenges, each step bringing them closer to the truth. But as they delve deeper into the shadow's domain, they realize that their enemy is more formidable than they ever imagined. With the fate of Terraworld hanging in the balance, Violett and her companions must stand together and confront their own inner demons if they are to have any hope of overcoming the darkness that threatens to consume them all. Terraworld: We Are The Broken Ones...,is a gripping tale of courage, sacrifice, and the enduring power of hope in the face of adversity. Join Violett and her companions as they embark on a journey that will test their limits and define their destiny in the shadow's dark embrace.
You may also like
Slide 1 of 10
Fall of the Terran Empire - Traci Ganner series book 1 cover
Descendants of Rome (#3 in Gladiator Series) cover
HSC Battlecruiser Series Book 2 "Planet 2110" cover
Terran Oblivion cover
Return From Exile cover
Orion Gambit - Traci Ganner series book 2 cover
Astronomer cover
Waymakers (Champions of the Crystal Book 9) cover
The Tree of Life: Enoch's Children Book 7 cover
TerraWorld~We Are The Broken Ones...(#4) cover

Fall of the Terran Empire - Traci Ganner series book 1

21 parts Complete

Resisting the cruel, conquering machine of the mighty Terran Empire, the Orion Star Cluster locks its fledgling navy in combat with one of the most brilliant Terran admirals in its history. But Orion's only chance rests with a discovery made by a young imperial cruiser commander named Traci Ganner. In a routine Pirate patrol, Ganner discovers a new world defended by Strike Fighters; a technology neither the Terran Empire nor Orion Clans possess. In a bid to save them both, Ganner devises a cunning plan, a plan that will come with a terrible price. To succeed, she must secretly unleash an unthinkable force and continue to stay one step ahead of everyone until it is time to reveal the truth. She is pitted in a game of wits against the highest levels of Imperial Command, including the Emperor himself, in order to save her own life, and those she cares for.

More details