Glory and Empire
grandmobiusbrian
  • Reads 391,717
  • Votes 4,162
  • Parts 28
  • Time 7h 1m
  • Reads 391,717
  • Votes 4,162
  • Parts 28
  • Time 7h 1m
grandmobiusbrian
Complete, First published Aug 02, 2012
admiralsagronbattlesdesertdrauldreadnoughtempirefallfictionfleetsgannerhyperspacekendahlmurdermysteryparanormalpearsonportalsalabastsciencespacestarterrantimetravel
The Terran Empire is in a state of chaos after the successful sack by the Valdi armada.  As the Terran fleets struggle to reorganize, First Marshal Scott Pearson led the charge to cut into the enemy flank and stem the tide of reinforcements.  With Orion help, he was succeeding, until Captain Traci Ganner interfered--again.
  
But Traci must bring the Terran marshal and the chief Orion councilor together to confront a new Terran threat from the future.  Facing daunting new technology, Traci finds herself in the clutches of a new Terran enemy and if they force the location of the rift from her, both the Terrans and Orions will be lost.

In the final book of the Traci Ganner trilogy, Traci and her officers must endure their most difficult trials yet that leads Traci to a mystical temple that holds the keys to her very survival.
All Rights Reserved
admiralsagronbattlesdesertdrauldreadnoughtempirefallfictionfleetsgannerhyperspacekendahlmurdermysteryparanormalpearsonportalsalabastsciencespacestarterrantimetravel
Table of contents

28 parts

Sign up to add Glory and Empire to your library and receive updates
or
#23hyperspace
Content Guidelines
You may also like
Outsystem: A Military Science Fiction Space Opera Epic by soyarma
4 parts Complete
In the spirit of great Space Opera by Peter F Hamilton, Jack Campbell, and Larry Niven comes Aeon 14. If you love strong heroines like Kris Longknife, then you're going to love Tanis Richards. Major Richards needs to get out of the Sol System Demoted by the military and hung out to dry, the media labels her the Butcher of Toro. Despite her soiled record, Tanis still one of the best military counter-insurgency officers in the Terran Space Force. And they need her to find the terrorists responsible for trying to destroy the GSS Intrepid, a massive interstellar colony ship in the final phases of construction at the Mars Outer Shipyards. It'll be her ticket out of the Sol system, but Tanis discovers she is up against more than mercenaries and assassins. Major corporations and governments have a vested interest in ensuring the Intrepid never leaves Sol, ultimately pitting Tanis against factions inside her own military. With few friends left, Tanis will need to fight for her life to get outsystem. Contains violence and some foul language. 17+ recommended.
On the Job by albahawk
16 parts Complete Mature
Three months after meeting on Gorse, Hera Syndulla and Kanan Jarrus take on an easy job to pay the bills. But this simple cargo run turns out to be more complicated than they anticipated- in more ways than one. Disaster strikes in the form of gravity wells, interstellar parasites and one heck of an insurance swindle. Kanan and Hera have to maneuver through it all while trying to sort out their growing feelings for one another.
Stowaway: A Star Wars Rebels Story by MultiverseEnthusiast
44 parts Complete
Attempting to retreat from a losing battle, the Ghost Crew unknowingly jumps into a wormhole and crash lands on an unfamiliar planet. Seeing the fireball fall out of the sky, a recently unemployed boy - you - offers assistance to the crew, later ditching his home world after finding out he's been accused of multiple crimes while helping them escape. Now thrust into a war against an all-encompassing Empire, will he succeed in overthrowing them? Will he find a new purpose? And will he ultimately return home? Find out in his adventures with these new unlikely companions. Set just before Season Two. Book 1 of the Crossover Series Disclaimer: I do not own any of the characters or images belonging to the Star Wars universe, as those rights belong to Disney. I also do not own any custom-made images or fan art used in the making of this book, and the artists will be credited as such at the beginning of each chapter if applicable. Trophy Case: 🥇 in #zeborrelios - 10/8/2023 🥇 in #ghostcrew - 11/11/2023 🥇 in #herasyndulla - 11/25/2023 🥇 in #rebels - 12/9/2023 🥇 in #starwarsrebels - 10/16/2024 🥈 in #malereader - 10/7/2023 🥈 in #sabinewren - 3/20/2024 🥈 in #kananjarrus - 3/25/2024 🥉 in #ezrabridger - 9/2/2024
A Boy and His Bug by AJandHisBrokenworld
34 parts Complete
Since Humanity united under one rule nothing was out of their reach, not even the stars... In their quest to find other sentient life they ended up finding more than they could have ever bargained for. Simon is a rebel and traitor to his home world, the fourth planet from the second sun. even so he manages a quiet life working in a mining core, but that all changes when he saves a young woman that he names Lilith. Lilith is a scientist who works on helping solve the galaxies biggest issue, The Diplurians! together they team up on an epic adventure to save the galaxy from this interstellar threat, though as it turns out, not all is as it seems. Join them in this thrilling mystery adventure novel set in the far future, and remember, trust no one!
TerraWorld~We Are The Broken Ones...(#4) by KevinTheKitsune
21 parts Complete
In the aftermath of a harrowing battle, the world of Terraworld teeters on the brink of darkness. As the dust settles and the echoes of combat fade, a new threat emerges from the shadows, casting a pall of uncertainty over the land. Violett and her companions, weary but resolute, find themselves confronting an enemy unlike any they have faced before. The shadows that once lurked at the edges of their world now surge forth with renewed vigor, their sinister intent shrouded in mystery. As tensions rise and alliances are tested, Violett and her companions must journey into the heart of darkness to confront the source of the shadow's power. Along the way, they will encounter new allies and face unimaginable challenges, each step bringing them closer to the truth. But as they delve deeper into the shadow's domain, they realize that their enemy is more formidable than they ever imagined. With the fate of Terraworld hanging in the balance, Violett and her companions must stand together and confront their own inner demons if they are to have any hope of overcoming the darkness that threatens to consume them all. Terraworld: We Are The Broken Ones...,is a gripping tale of courage, sacrifice, and the enduring power of hope in the face of adversity. Join Violett and her companions as they embark on a journey that will test their limits and define their destiny in the shadow's dark embrace.
Descendants of Rome (#3 in Gladiator Series) by milly_king818
60 parts Complete
Nearly two decades have passed since Krista and her band of gladiators won their freedom, but the empire is far from peaceful. The Colosseum still remains and with their escape scarring Rome's history, the emperor's hunger for power has never been greater. Extinguishing all attempts at rebellion, it is only a matter of time before the enslaved people of Gallia take a stand against their tormentors. Fearing another slave rebellion, the Emperor Trajan orders the legions of Rome to march on Gallia. * * * Born to two gladiator parents, Lazarus's dreams are filled with following in their footsteps and fighting upon the sands of the arena. With his trusted friend by his side, Lazarus will make the journey to Rome only to find his future of glory thrown into turmoil. The arrival of his parents in Rome has set off a chain of events that will test Lazarus's bravery and skills to the limit. With a new young commander threatening his loved ones, Lazarus must choose between a life of glory and a life of freedom. And with everything not being what it seems, can Lazarus make his parents proud or will he die trying? _________________________________________________________ Non est ad astra mollis e terris via. There is no easy way from the earth to the stars. __________________________________________________________ Book 3 of the Gladiator series. All Rights Reserved. Photos belong to their original owners.
Wars Amongst the Stars: Rebellion: Vol. 2 by theatregirlsmp
54 parts Complete
A Long Time Ago In a Galaxy Far, Far Away... With the successful rescue of Jedi Knight KANAN JARRUS and Jedi Master AR'IABEL QUINARA, the Rebellion is larger, and more known than ever. The Empire is on the offensive against this larger threat, with Darth Vader at the driving helm. As soon as she is able, the Jedi Master leaves, with only a holocron note left behind. She doesn't say where she's going, or if she'll be back. Master QUINARA is on the planet Tatooine where an important discussion will occur. This story is based on season 2 of Star Wars Rebels.
Gods of Garran by Meredithskye
52 parts Complete
--Only an ancient power can fight an alien race.-- Once the Borrai, the Gods of Garran, walked among the people, taming the wind and the fiery mountains. Then invaders came from the sky and killed the gods--destroying all who opposed them. A hundred years have passed since the Invaders came from the sky--an advanced alien race known as the Chanden. Now, having suffered many grievances at the hand of the aliens, the tribesmen rise up to find the god-stones and revive the ancient powers of the Borrai--and reclaim their world. As a son of the clan chieftain, Morrhan can't do anything right. His father disapproves of everything he does. When his father decides to seek revenge on the technologically advanced Chanden, once again Moorhen finds himself in opposition to his father. The fate of his tribe hangs in the balance. Should Moorhen follow his conscience-or his father? Meanwhile, when the Chanden learn of the search for the god-stones, they send a spy to infiltrate the Garrans--a young woman named Asta, who has her own reasons for hating the Garrans. She begins to realize that they are dealing with a real power and not a superstition when they get close to finding the god-stones. Could the Chanden be in the wrong? ________ This novel is complete here on Wattpad. The Gods of Garran is available on Amazon in Kindle and paperback. http://amzn.com/B00FGLUI00 #theooohrahs #featured
The Tree of Life: Enoch's Children Book 7 by Cyrano00
46 parts Complete
The aliens, the Nimobes, have settled into their city many miles south of Jasper on the open land north of the Grand Canyon. They watch the people in Jasper, and have developed a relationship with them through the doctor that was supposed to spearhead the invasion, but protected the town instead. But hidden in the upper eschelons of their leadership, the war with Earth is about to take a dramatic resurgence, and Mordechai, the Nimobe doctor, is the only one who can stop it. The deadly spiders that the Nimobes waged a constant battle with back on their homeworld, stowed away on their ships and arrived in their new city with an agenda of their own. Cory, Thomas and Virgil visit the great tree, revered by Virgil's people and hidden deep in the caverns he lived in for most of his young life, to see if they can save it. Since the caverns were opened the tree has been slowly dying. They have to recover from the strange oath they've been put under, and return to normal life. But can they do it, or will them remain forever under the control of Wilks and his followers?
The Bonds of Duty (Thrawn x OC) by ChroniquesAstrales
49 parts Complete Mature
In a galaxy where the struggle for power crushes the weak, Aelinara Sylorin, exiled heir to the throne of Valkorin, embarks on a solitary and determined quest to restore her people's honor. Her once-prosperous world has been conquered by the Galactic Empire, leaving its culture in ruins and its future uncertain. Scarred by the loss of her parents-a courageous queen and a Jedi master-Aelinara has spent a decade exploring forgotten Sith temples, unraveling the secrets of the Force, and seeking ways to overthrow Emperor Palpatine. Under a false identity, she infiltrates the inner workings of the Empire and crosses paths with Thrawn, an imperial Admiral as brilliant as he is enigmatic. Intrigued by her intellect and deep knowledge of ancient cultures, Thrawn sees her as a valuable ally for his own strategic plans. In turn, Aelinara recognizes in him a rare opportunity to access critical Imperial resources for her mission. Between them forms a fragile alliance, fraught with distrust yet driven by common goals. When Aelinara reveals her true identity and intentions to Thrawn, their unlikely partnership evolves into a complex bond, teetering between distrust and respect, attraction and duty. Together, they tread the treacherous terrain of precarious alliances and potential betrayals, all while uncovering the true power of the Sith artifacts they seek. These relics, remnants of an ancient and dangerous power, may hold the key to weakening the Emperor-but wielding them comes with immense risk. Aelinara walks a razor's edge: between betrayal and trust, rebellion and submission, light and shadow. In this fight for survival, she must not only choose her allies but also determine what kind of sovereign she wishes to become for her people.
You may also like
Slide 1 of 10
Outsystem: A Military Science Fiction Space Opera Epic cover
On the Job cover
Stowaway: A Star Wars Rebels Story cover
A Boy and His Bug cover
TerraWorld~We Are The Broken Ones...(#4) cover
Descendants of Rome (#3 in Gladiator Series) cover
Wars Amongst the Stars: Rebellion: Vol. 2 cover
Gods of Garran cover
The Tree of Life: Enoch's Children Book 7 cover
The Bonds of Duty (Thrawn x OC) cover

Outsystem: A Military Science Fiction Space Opera Epic

4 parts Complete

In the spirit of great Space Opera by Peter F Hamilton, Jack Campbell, and Larry Niven comes Aeon 14. If you love strong heroines like Kris Longknife, then you're going to love Tanis Richards. Major Richards needs to get out of the Sol System Demoted by the military and hung out to dry, the media labels her the Butcher of Toro. Despite her soiled record, Tanis still one of the best military counter-insurgency officers in the Terran Space Force. And they need her to find the terrorists responsible for trying to destroy the GSS Intrepid, a massive interstellar colony ship in the final phases of construction at the Mars Outer Shipyards. It'll be her ticket out of the Sol system, but Tanis discovers she is up against more than mercenaries and assassins. Major corporations and governments have a vested interest in ensuring the Intrepid never leaves Sol, ultimately pitting Tanis against factions inside her own military. With few friends left, Tanis will need to fight for her life to get outsystem. Contains violence and some foul language. 17+ recommended.

More details