Story cover for RWBY Across Dimensions (Ruby x Peter Parker) by Swivel-Man
RWBY Across Dimensions (Ruby x Peter Parker)
Swivel-Man
  • Reads 6,121
  • Votes 63
  • Parts 14
  • Time 1h 5m
  • Reads 6,121
  • Votes 63
  • Parts 14
  • Time 1h 5m
Swivel-Man
Ongoing, First published Mar 21, 2019
belladonnablakecrossoverdimensionsfanficironmanjnprlongmusicmçuparkerpeterroserubyrwbyrwbyfanficschneespider-manteamweissxiaoyang
Some how the team leader of Team RWBY Ruby Rose is thrown into another dimension (The MCU) and meets the one and only Spider-Man/Peter Parker and she will have to adjust to living in this odd universe until the rest of Team RWBY and her friends find a way to get her back.

P.s I don't own RWBY, Mavel, or any artwork that I may use.
Public Domain
belladonnablakecrossoverdimensionsfanficironmanjnprlongmusicmçuparkerpeterroserubyrwbyrwbyfanficschneespider-manteamweissxiaoyang
Table of contents

14 parts

Sign up to add RWBY Across Dimensions (Ruby x Peter Parker) to your library and receive updates
or
#344long
Content Guidelines
You may also like
Monster vs Aliens (RWBY vs Aliens Rewrite) by SethEaton1
11 parts Complete
Just before graduation, Ruby Rose is hit by something, and it transforms her into a giant 50 ft tall teenage girl. Now, she has to work with other people that were once humans and Faunus as well, and stop an alien invasion. (OC's Included)
Infinite Universe for Y/N L/N by Balasubas19
7 parts Complete Mature
Do you ever believe in the multiverse theory? The theory that are multiple dimensions where any and every single possibilities are endless? Sounds crazy right? But what if I told you that this is true? Y/N, L/N, a teenage kid in beacon, has a good reputation and he was known in beacon. He thought that he was meant to become a hunter.... But oh boy.... He has endless possibilities on the multiverse. How will team RWBY and JNPR will react to this? Come and join with them! Universes included: Final Fantasy VII Final Fantasy XIII Final Fantasy XV John Wick Kingdom Hearts Devil May Cry Halo Red VS Blue Jojo's Bizarre Adventures Dragon Ball Z/Super Metal Gear Rising Revegeance Spider Man PS4 Marvel DC -And Many more!
Rwby comes to the real world by Codegeass2023
20 parts Ongoing
What happens if team RWBY never fell in the Ever after but instead went to the real world after falling through the portal and arriving earth. Let see how team rwby will get back home with the help from someone name Y/n L/n.
RWBY: No Way Home by REAVER508
39 parts Complete Mature
- Remnant #1 "In spite of everything you've done for them... eventually they will HATE YOU" After defeating Salem, Ruby's life became increasingly difficult. In a desperate attempt to fix her life, Ruby sought out help from professor Goodwitch. Ruby's plan didn't work out the way she thought it would, now her enemies from every universe is out to get her.
Rwby: 13 Elemental Forces x Justice League/ Superheroes and Huntsmen Part 2 by MrEhero-Ultimate
8 parts Complete
After the events of the Justice League and three teams of Huntsmen and Huntresses were trapped in a virtual prison, they must team up again to save the world of DC. Now Team RWBY and HSRM must travel to another dimension to help the Justice League face off against a familiar enemy from the dimensions of both DC and Rwby. (I do not own RWBY or Justice League, Rwby and it's original characters are owned by Rooster Teeth as Justice League and it's original characters are owned by DC Comics.) (I don't own any images or videos unless they are drawings or artwork I've done myself.)
Teens and a Queen on Earth [RWBY/Earth] by ZeSovietMan
16 parts Complete Mature
What happens when the Fall of Beacon plan failed, and Salem decided to take matters into her own hands. At the same time, Team RWBY was patrolling Vale's walls. But a portal takes all of them to a new world. All Rights Reserved to Rooster Teeth. All pictures, audio, and other forms of art belong to their respected owners.
Two Faunus In Love: OC Black Panther x Blake Belladonna by SonicKev101
11 parts Complete
(A/N: Another love story of OC Spider-Man x Ruby Rose + OC Iron Man x Weiss Schnee. This time, It's about my OC Black Panther and Blake Belladonna love story. So, let's have a look shall we.)
The Dragon Gamer Of Remanant (Adoption) by LupusNoir00
36 parts Complete
This story is about a gamer who got transported to the world of Remanant. He spawns in the jungle with his trusty system Mira,But there is a big mishap. Instead of being spawned as a Dragon fanaus he gets spawned as a whole Dragon! Unable to go into society he stays in the forest killing grimm to level up. Him and Mira were fine settling into there new environment. That was until their environment was stopped by their first quest. To save team R.W.B.Y. So with the beginning of their quest this is the start of the Dragon Fanaus of Remanant.
Jaune's Multiverse Madness! by RocknRoll7575
17 parts Ongoing
You already know what this is about! Watch as Team RWBY and JNPR Watch the many lives of Jaune through the Multiverse!
RWBY Boys:A Rose by any other name by Williamjwb87
31 parts Ongoing
In an alternate Remnant, where legends are forged under the weight of heroes and hunters, a twist of fate has altered destiny. Ruby Rose is no longer the bright-eyed scythe-wielder of Team RWBY. Instead, meet Ross Rose, a confident yet soft-hearted young man with a passion for helping others, an obsession with weapons crafting, and an unwavering dream to become a great Huntsman. But as he begins his journey at Beacon Academy, Ross discovers that fighting Grimm might not be his greatest challenge-it's navigating the whirlwind of emotions stirred by the people closest to him. he also hides that he only wants to be a Huntsmen to bring his mother back home, and that is it. His motivation is to just bring his mother home. Along the way he will meet a bunch of people that will try to stop him and he won't allow it. And as well as some relationships that will go the wrong way,So Will our boy make it out alive from all the Grimm and women?
You may also like
Slide 1 of 10
Monster vs Aliens (RWBY vs Aliens Rewrite) cover
Infinite Universe for Y/N L/N cover
Rwby comes to the real world cover
RWBY: No Way Home cover
Rwby: 13 Elemental Forces x Justice League/ Superheroes and Huntsmen Part 2 cover
Teens and a Queen on Earth [RWBY/Earth] cover
Two Faunus In Love: OC Black Panther x Blake Belladonna cover
The Dragon Gamer Of Remanant (Adoption) cover
Jaune's Multiverse Madness! cover
RWBY Boys:A Rose by any other name cover

Monster vs Aliens (RWBY vs Aliens Rewrite)

11 parts Complete

Just before graduation, Ruby Rose is hit by something, and it transforms her into a giant 50 ft tall teenage girl. Now, she has to work with other people that were once humans and Faunus as well, and stop an alien invasion. (OC's Included)

More details