Story cover for CELYN MARQUEZA by Marivlind
CELYN MARQUEZA
Marivlind
  • WpView
    Reads 156
  • WpVote
    Votes 22
  • WpPart
    Parts 11
  • WpView
    Reads 156
  • WpVote
    Votes 22
  • WpPart
    Parts 11
Marivlind
Ongoing, First published May 02, 2019
accidentadventurebarriobillionairefamilyfreakfriendshipgirlhighschoolhothumorkidnappedlostprobinsyarichromancesummerromancethecallalilyawardsthriller
"Oh my God Celyn, drive faster!"

"I know! That's what I'm doing."

I don't know why they are following us, but I'm pretty sure they want us. Maybe, to kidnapped us and call our parents for a ransom money.

For the past years hindi mawalawala ang ganitong scenario. Lalabas kalang sandali sa bahay may sumusunod na sayo.

Sa apelyidong nakatatak sayo paniguradong mangayayari talaga yan sayo. I felt so tired of this scene and now it is happening again at nataon pang walang guards na nakaalalay at nagbabantay sayo.

Running and saving our freaking lives is what I've never expected. I'm just having my summer vacation and this is what happens?

"Celyn faster!!"

"Shut up George!!"

I drive faster just to be away of those jerks. Hindi ko na alam kung saang lugar na ito basta makalayo lang kami sa kanila. I just hope our buttler's will find us as soon as possible.

"CELYN WATCH OUT!!"

When i look what George was pointing I immediately turn the car to my right but I didn't expect na bangin pala iyon. 

"P-please sa-save us..."
All Rights Reserved
accidentadventurebarriobillionairefamilyfreakfriendshipgirlhighschoolhothumorkidnappedlostprobinsyarichromancesummerromancethecallalilyawardsthriller
Table of contents

11 parts

Sign up to add CELYN MARQUEZA to your library and receive updates
or
#678girl
Content Guidelines
You may also like
Ang Misteryosong Kaso Ng Pagkawala Sa Isla Paradisio (Book 1) by JondZero11
92 parts Complete
****Author's Note**** If you are reading this story on any other platform other than Wattpad, you are very likely to be at risk of a Malware attack. If you wish to read this story in it's original, safe form, please go to https://www.wattpad.com/story/257040916?utm_source=android&utm_medium=link&utm_content=share_writing&wp_page=create&wp_uname=JondZero11&wp_originator=3CdTAOyDZxOGCnstIx6HedcaklkX3yZ%2Fqtxk%2FPSSUcOcftReUGE5VxwimjZJVTYMzsd96L%2BljmtvKGnqp4MPEgMq9yuAjnOHZfXMu2azCyEsojaaLESEwguV4diqS5o3 Thank you and good day PLIAGARISM IS A CRIME!! ********************************************* Dalawang buwan ng bakasyon sa Isla ng Paradisio ang inaasam dapat ng mag-amang Archie (14 taon gulang) at si Arman (38 taong gulang) na malayo sa siyudad upang makapagpahinga at magliwaliw. Ngunit sila'y madadawit sa kaso ng hindi maipaliwanag na pagkawala ng ilang mga tao sa isla. Anu kaya ang dahilan ng pagkawala ng mga taong ito at kinahinatnan nila bago sila nawala? Anu din kaya ang magiging papel ng mag-ama sa kasong ito?
Branded Series Book 4: Jarine (COMPLETED) by BinibiningAbbott
34 parts Complete Mature
Sabi nila you can't control who you fall for. Pero pano kung na -fall ka sa taong feeling mo ay hindi karapat-dapat para sa'yo? Kasi alam mong may mali sa'yo. Hanggang kailan mo kayang pigilan ang iyong sarili kung nilalandi ka niya ng bongga? Susugal ka ba kahit alam mong may posibilidad na hindi ka niya matatanggap? *Jarine joined the group* 😂 WARNING: SPG Content/ R-18 Read at your own risk. May mga kahalayan po ang kuwentong ito, sorry na agad. I'm a trying hard writer so please bare with me sa lahat ng errors. This is my first time writing, lalo na ng SPG thingy, so kung hindi man kayo ma-satisfy, I apologize in advance. Masyado pa kasi akong inosente sa mga ganyan (chos). There might be some typo and grammatical errors since I'm only human, nagkakamali din, and I'm not really good in english. Feel free to correct me po. Para maitama ko naman ang aking pagkakamali. Thank you so much 😘 XOXO
LIES AND TRUTH (ONE-SHOT STORY) by FoxyFridz
1 part Complete
“NOOOOOOOOOOOO!” Malakas na sigaw ng isang dalaga. Dinig na dinig ang boses nito sa buong kabahayan sa lakas ng pagkakasigaw nito na nagmumula sa may study room. “Calm down Collette. Why are you screaming at your father?” anang ginoo na ama ng dalaga. “You want me to calm down? You want me to CALM DOWN? For goodness sake dad, how can I calm down when you want me to marry a stranger all of a sudden? Dad, this is insane!” histerikal na wika ng dalaga. “Hija, Axel is a good guy. And I know he will be a responsible husband for you. He’s smart, handsome and rich. He can help you manage our business when I’m gone.” Anang kanyang ama. “And he is your childhood friend before his family migrated abroad. Hindi mo na ba siya natatandaan. “No! You cannot drag me into this foolishness of yours!” ani Collette. “Hindi ko siya natatandaan at kung matandaan ko man siya, di ko pa rin siya pakakasalan.” at tumayo na para iwan ang kanyang ama. Collete couldn't understand her father for bringing up that arranged marriage all of a sudden. Axel is part of his past and she already buried his memories together with their friendship. Kaya naman hindi niya maintindihan kung bakit bigla na lang itong susulpot sa buhay niya at gusto siyang pakasalan. She needs to find a way to escape at ang tanging paraan na naisip niya eh ang tumakas at manirahan sa isang pribadong isla na pagmamay-ari ng dati niyang manliligaw. But what if destiny steps in and she meet someone she would fall for? Will she go for it to revenge with her father or will karma walks in?
Objection, Your Honor! I'm the Villainess?! by MoonSeen
65 parts Ongoing
I used to be the undefeated queen of the courtroom-Alexis Reyes, the baddest, sassiest, most feared lawyer sa buong Pilipinas. Walang kaso na hindi ko napanalunan. Until... BAM! I woke up sa isang romantic harem novel. And guess what? Ako yung kontrabida. Oo, ako si Celestine Alcantara-heiress ng Alcantara Medical Empire, mayaman, glam, at certified mean girl. Kalaban ko? Yung so-called mabait at pure-hearted female lead, si Liana Cruz. She's the adoptive daughter of the CEO ng rival hospital chain. Pero teka, bakit ako ang mas relateable? Bakit parang ako yung pinagtutulungan ng universe? To make things worse, and by worse I mean juicy... I'm surrounded by four walking red flags: - A cold but dangerously hot CEO na may hidden soft side. - A smug hotshot lawyer na parang version ko sa OG world. - A charming doctor na mas makinis pa sa baby oil. - At isang sexy celebrity chef na laging may pa-sweet na pagkain... and kilig. They're all supposedly in love with Liana. Pero bakit parang ako ang binibigyan ng screen time ngayon? Plot twist ba 'to o character development? Now I have two choices: follow the script and face my "tragic" ending... or rewrite the story, make them fall for me, and prove na kahit villainess ako, I slay-with or without a gavel. This is not your typical love story. This is my cross-examination with fate. Game ka na ba, Your Honor?
MY GIRLFRIEND FOR HIRE! by mirae_meee_plis
39 parts Complete Mature
"enjoying the view?" Gulat akong napatingin sa pinanggalingan ng tinig na iyon. Then I saw Faris Rein Cervantes standing near me, quietly watching me while her hands are on her pant suits pocket, wearing her business attire, looking at me with her unreadable eyes. "Glad you came with my secretary here. Did she excuse you to your class?" She continue asking. "I don't know why I need to be here." I said confusedly instead of answering her. "I thought we're okay now? Na bayad na ako sa nagawa ko sayo?" Tumango ito bilang sagot bago humakbang patungo sa upuan na katapat lang ng sofa na inuupuan ko at umupo rin doon. "B-bakit mo pa ako hinahanap?" Matagal itong hindi sumagot at seryosong nakatitig lang sa aking mga mata na ginantihan ko naman ng nagtatanong na tingin. Ilang sandali pa ang lumipas bago ito nagsalita. "Because I need you." Nanlaki ang mga mata ko sa sinabi nito. Matapos ay natulala lang ako dito while still processing on my mind what she mean by that. "I still need you to act as my girlfriend." Pagpapatuloy nito. "Let's continue pretending, Miss Fontejar." Tuluyan na akong napatanga sa kanya. Oh my goshhh... What is happening to the earth???! I know that she's open to the public about her sexuality. Pero hindi kaya nababaliw na siya?? Who would be crazy to believe that a cheerleader STUDENT like me will be the girlfriend of as goddess as FARIS CERVANTES??! The famous young billionaire! The one who holds the title of the most SNOB most SERIOUS most COLD woman! and never give a d*mn to smile as if it's the most stupid thing to do. Ngayon, sino naman ang lolokohin naming maniniwala na papasa akong girlfriend niya? Hellooo... im just a simple cheerleader Queen Bee na ang hobbies bukod sa magpahagis sa ere ay ang mainggit sa love life ng mga kaibigan ko!
ALONGSIDE YOU (Royalty Series #2) by KwinYen
67 parts Complete Mature
SHE WAS HUMILIATED BY HER CRUSH "I'm sorry, but I don't want a conservative girls like you to become a part of my collections. I admit your beauty is impressively and extremely different from my women in bed. Pero yung mga katulad mo ang matatawag kong boring sa kama. Palagay ko rin ay hindi ka papasa sa mga ipapagawa ko sayo. I'm dominant when it comes to s*x. Pero kung ipagpipilitan mong karapat-dapat kitang pag-aksayahan ng oras, you can beg. Kneel before me and beg for my pleasure." BUT SHE FOUND A NEW FRIEND "Hi! I'm Zill. Sorry for eavesdropping, I just can't take it lalo't pinapahiya ka na nya." "I'm Kelsey." Pakilala ko. "Ooy! Ooy! Ano bang meron sa araw na'to? Halos lahat yata ng naggagandahang babae lumalapit sa'kin? Haha. Sorry girls pero may date ako ngayon." Mayabang na sabi nito. "HAHAHA! You're kidding, right?" Natatawang insultong tanong ni Zill. "Ako? Magkakagusto sayo? Excuse me, pero yang mukha mo, wala pa sa kalingkingan ng kakambal ko. Ano bang pinagmamalaki mo? Ang kayabangan ng dila mo? O ang mukha mo na hindi ko naman alam kung dapat ba talagang ipagmalaki?" SHE WAS BETRAYED BY HER BESTFRIEND "K-kelsey? L-let me e-explain." Natatarantang sabi ni Rachel. SHE WAS NEARLY RAPED BY SOME DRUNKARD "Haha! Ang galing natin tsumamba!" Sabi nung lalakeng nasa kaliwa ko. Hinawakan naman kaagad ng isang lalake ang magkabilang kamay ko at inilagay iyon sa likod. I'm screwed up.. BUT AT THE END OF THE DAY, SHE FOUND A NEW LIGHT... "Tss!" Singhal nya. "Hey! Woman, I couldn't care less about your naked body. But this is my territory. I'm preventing any crime and maintaining the peace and order within my premises. If you want to experience the same thing again without my help, you can leave inside my domain." He coldly said. Napansin ko lalo ang sobrang gwapong mukha nya. He's beyond perfection. I can't compare him to just anybody else. Like I didn't know na nag-eexist ang mga ganitong mukha sa mundo. She is KAYE ANTHEA KELSEY ALONSO.
The Rose: Mistaken Identity (Book 1 of THE ROSE Pentalogy) COMPLETED by Emill_Lia
103 parts Complete
Hello Roses! After a three year hiatus, I am finally back! To the readers of The Rose, I apologize for the not updating the story for a long time - really long time. I was busy at work and school, and so I had to postpone updating it. A family member of mine encouraged me to continue writing the story. She was delighted to see the positive comments you guys left, and no one appreciates it more than I do. It truly makes me happy! Now, I promise you that I will keep you updated with fresh chapters every week to keep the story going. I re-read the entire story, and I found out that there are a lot of things to improve(grammar, scenarios, plot), and so I decided to edit the entire story starting from the very beginning(this occupied most of my time). Yes, please feel free to re-read the story from the very beginning because a lot of scenarios were added for your convenience! :) I apologize in advance to the readers for the grammar/spelling/typo mistakes. No excuses, I am obviously not an expert! However, please feel free to message me for the corrections anytime, and I would gladly edit it. Lastly, napansin niyo siguro - bakit parang ang tagal magka-developan nung mga bida? At bakit ang dami nilang dialogues together? Well, that is because I want the lead characters to create a memorable time together. You will figure out what I mean as you read along . And most importantly, I want to highlight how a normal conversation between two people are - that it is not fast paced, and a lot of things really do happen in a day. :) That's it for now! Please enjoy it, and let's make magic! ;) For Book 2 of The Rose, kindly click on the link: https://www.wattpad.com/313442036-the-rose-a-withered-petal-book-2-of-the-rose
Grandpa Killian's joy by Isol_dee
15 parts Ongoing Mature
Isang tambay na ang trabaho ay isang magician o kaya clown sa mga available na event. He is forever jealous of his friends or people at his age- already a professional. He wants to travel abroad even if just once! His name is Raymond. Sana may makapansin sa kanya kahit naman marami na siyang nagawang mali sa buhay o padalos dalos na desisyon. Until he is heard... one interview from an attorney and him being also a client. He offered to have a friend abroad to maybe help solve a case. Could this be a life changing moment o isang maling desisyon? ----- Language: Filipino mixed with English Cover not mine, so credits to the rightful owner.
Tears of the Girl Named Sea (COMPLETED) by imunknownperson
32 parts Complete Mature
TEARS OF THE GIRL NAMED SEA "Sigurado kana ba? Wala ng bawian ito anak." Tumango ako pagkatapos ay sinara ang malaking maleta. "Wala po Dad. Salamat sa lahat." "You don't need to say thank you, that's what parents do." Huminga ito ng malalim. "Sandali lang tatawagin ko ang Mommy mo para matulungan ka sa pagiimpake." Dumating ang araw ng pagalis ko, malungkot akong nagpaalam sa magulang ko. Napagdesisyunan kong hindi gamitin ang ebidensiya at hayaan na ang hukuman ang humusga. Hindi na rin ako nakaattend ng huling hearing dahil tumapat ito sa flight ko. ---------- "Ma'am you want coffee?" Napabalik ako sa kasalukuyan ng magtanong ang flight attendant. "No, thank you." Sagot ko. Napasandal ako sa kinauupuan at napakagat sa labi ng maalala ang naging desisyon ko. Pinagisipan ko itong mabuti, inaral ko ang posibleng epekto nang magiging desisyon ko. At dun nga pumasok sa isip ko na itigil ito. Ang dami nang nadamay, nasaktan dahil sa galit ko. Iba talaga kapag galit ka, wala kang makialam kung sino ang matamaan, hindi ko man lang naisip na may pamilya silang walang kinalaman ngunit nasasaktan. Ayoko nang baguhin ang buhay nila dahil sa pagkakamali na matagal na nilang pinagsisihan. Hindi ako Diyos para magpasya sa kaparusahan nila, kung Diyos nga nagpapatawad paano pa kaya ako. Masaya akong nakilala sila, lalo na si Lucas binago niya ang buhay ko. Marami siyang tinuro sakin, siguro kung hindi ko siya nakilala nandun parin ako sa point na hinahanap ang sarili ko. He became my life, my everything. I loved him so f*cking much at umaasa akong magkikita ulit kami pagdating ng panahon. Kung hindi man... mananatili siyang parte ng nakaraan ko na hinding hindi ko makakalimutan. ⚠WARNING: PLAGIARISM IS A CRIME
ES-2 (Rain) by Jahmcrisian9189
24 parts Complete Mature
"Itigil ang kasal...!!!!" I heard the familiar voice inside the church, it's crazy you know we just meet and talk a few hours ago and now I even recognize her voice. I don't know what gotten in me that I walk inside the church and there I saw the girl She was standing at the middle of the beautiful decorated isles, she was about to cry but she was trying hard to hold her tears. "Alicia..what are you doing?" I saw the groom and the bride was shock, people are whispering around. "Kito, diba ako naman ang mahal mo? Diba? bakit? Bakit ganito? Bakit Michelle?" her tears are already on the verge of falling, "Alicia, you couldn't understand? kahit kailan di na ako babalik sayo kahit mamatay pa ako" I heard the groom said, damn! too much drama, "Peru mahal na mahal kita Kito..sobra kitang mahal" she suddenly wailed hard, she sounds like a slaughtered cow! I walk to the girl and hold her hand nakita ko pang nagulat siya na nakita niya ako, well I am more even surprise myself why I am doing this. "Let's go" I said as people continue to murmur around us. "Peru...Kito.." I clearly heard the desperate tone of her calling, damn! this things people can do for love "Let's go Alicia" I firmly said before I started to walk outside holding her hand tightly, she seems reluctant at first as she made a final glance to the couple. Damn this thing called love! *This story is pure fiction anything that resembles in reality is not intended by the author* *There are a lot of grammatical errors, construction errors ahead I will advance my apology*
You may also like
Slide 1 of 10
Ang Misteryosong Kaso Ng Pagkawala Sa Isla Paradisio (Book 1) cover
Branded Series Book 4: Jarine (COMPLETED) cover
LIES AND TRUTH (ONE-SHOT STORY) cover
Objection, Your Honor! I'm the Villainess?! cover
MY GIRLFRIEND FOR HIRE! cover
ALONGSIDE YOU (Royalty Series #2) cover
The Rose: Mistaken Identity (Book 1 of THE ROSE Pentalogy) COMPLETED cover
Grandpa Killian's joy cover
Tears of the Girl Named Sea (COMPLETED) cover
ES-2 (Rain) cover

Ang Misteryosong Kaso Ng Pagkawala Sa Isla Paradisio (Book 1)

92 parts Complete

****Author's Note**** If you are reading this story on any other platform other than Wattpad, you are very likely to be at risk of a Malware attack. If you wish to read this story in it's original, safe form, please go to https://www.wattpad.com/story/257040916?utm_source=android&utm_medium=link&utm_content=share_writing&wp_page=create&wp_uname=JondZero11&wp_originator=3CdTAOyDZxOGCnstIx6HedcaklkX3yZ%2Fqtxk%2FPSSUcOcftReUGE5VxwimjZJVTYMzsd96L%2BljmtvKGnqp4MPEgMq9yuAjnOHZfXMu2azCyEsojaaLESEwguV4diqS5o3 Thank you and good day PLIAGARISM IS A CRIME!! ********************************************* Dalawang buwan ng bakasyon sa Isla ng Paradisio ang inaasam dapat ng mag-amang Archie (14 taon gulang) at si Arman (38 taong gulang) na malayo sa siyudad upang makapagpahinga at magliwaliw. Ngunit sila'y madadawit sa kaso ng hindi maipaliwanag na pagkawala ng ilang mga tao sa isla. Anu kaya ang dahilan ng pagkawala ng mga taong ito at kinahinatnan nila bago sila nawala? Anu din kaya ang magiging papel ng mag-ama sa kasong ito?

More details