Story cover for CELYN MARQUEZA by Marivlind
CELYN MARQUEZA
Marivlind
  • WpView
    Bacaan 156
  • WpVote
    Undian 22
  • WpPart
    Bahagian 11
  • WpView
    Bacaan 156
  • WpVote
    Undian 22
  • WpPart
    Bahagian 11
Marivlind
Sedang Ditulis, Pertama kali diterbitkan Mei 02, 2019
accidentadventurebarriobillionairefamilyfreakfriendshipgirlhighschoolhothumorkidnappedlostprobinsyarichromancesummerromancethecallalilyawardsthriller
"Oh my God Celyn, drive faster!"

"I know! That's what I'm doing."

I don't know why they are following us, but I'm pretty sure they want us. Maybe, to kidnapped us and call our parents for a ransom money.

For the past years hindi mawalawala ang ganitong scenario. Lalabas kalang sandali sa bahay may sumusunod na sayo.

Sa apelyidong nakatatak sayo paniguradong mangayayari talaga yan sayo. I felt so tired of this scene and now it is happening again at nataon pang walang guards na nakaalalay at nagbabantay sayo.

Running and saving our freaking lives is what I've never expected. I'm just having my summer vacation and this is what happens?

"Celyn faster!!"

"Shut up George!!"

I drive faster just to be away of those jerks. Hindi ko na alam kung saang lugar na ito basta makalayo lang kami sa kanila. I just hope our buttler's will find us as soon as possible.

"CELYN WATCH OUT!!"

When i look what George was pointing I immediately turn the car to my right but I didn't expect na bangin pala iyon. 

"P-please sa-save us..."
Hak Cipta Terpelihara
accidentadventurebarriobillionairefamilyfreakfriendshipgirlhighschoolhothumorkidnappedlostprobinsyarichromancesummerromancethecallalilyawardsthriller
Jadual kandungan

11 bahagian

Daftar untuk menambahkan CELYN MARQUEZA pada pustaka anda dan menerima kemas kini
atau
#678girl
Garis Panduan Isi
You may also like
I'm In Love With Ms. Author (GirlxGirl) COMPLETED oleh _jennex
39 bahagian Cerita Lengkap Matang
It all started with a 'Hi Miss!' Until followed by many messages that until now I still do not reply. "Ms. Author, kumain kana?" "Ms. Author, ingat sa buong araw ha, mamahalin pa kita." "Ms. Sing ganda ng mga libro mo ang magiging love story natin." "Ms. Huwag ng tumingin sa iba ha, baka tuluyan kang madapa at mahulog....sakin." "Ms. I'll introduce myself to you soon so just wait, okay?" "By the way, I'm your future wife." --- Like, who the hell is she?! Pina-prank lang ba ako nito?! For almost a year? Wala ba siyang ibang magawa sa araw-araw? Ang lala yata ng tama sa utak kaya napakalakas din ng trip sa buhay. Every day, I always wonder who this woman really is. She's obviously one of my readers. And the annoying thing is, I think my brain cells are running out of thoughts of why she had to send me nonsense messages every day. Argh! So I hired a private investigator to find her. I want her to stop as soon as possible because if she doesn't.... I might end up falling for her. AND THIS IS ALL HER FAULT!!
Bittersweet Hearts oleh iamagloriousmess
40 bahagian Cerita Lengkap
Dear diary, It's 2009. Wordpress is in [Wattpad is not yet out]. Uso sa munting school namin ang magsulat. Sis lahat naging instant authors. Bilang takot akong maiwanan sa trend, why not join the fun, di ba? Pwede kong gawin online diary itong blog while jotting my memories down. Maybe this can also distract me from my problems... Which reminds me, ano pa nga ba ang isusulat ko dito? Syempre, my life which has been a total disaster lately. Eto yung sneak peak: 1. Major family & love life issues last summer 2. Moved to a new country/home 3. Moving to a new school in the middle of high school 4. Going *baliw* soon... Charing. Call me a drama queen pero swear, nakakabaliw. Kalurky talaga. Abangan niyo nalang yung full ganaps and join me in my misery. Btw, don't worry, may mga kilig parts din siguro. I think? Secret nalang muna kung siney itech na nagpapatibok ng puso ng lola niyo. Shet, grabe yung kilig ko. Pero secret muna mga sez. For now, ito muna masasabi ko. I'll update soon! xoxo, Andy [Author's note: Tara, sabay sabay tayong marindi, kilabutin at balikan ang nakaraan!! :) actually I'm bringing back this story I wrote wayback in high school for nostalgia's sake. Gusto ko din ipreserve yung original, kaya ireretain ko yung most parts, pati language (taglish). Pero grabe yung kilabot ko sa ibang parts, bakit ang corny natin nung high school... Patawad po in advance! Most importantly, enjoy, mga beh! x ]
Ang Misteryosong Kaso Ng Pagkawala Sa Isla Paradisio (Book 1) oleh JondZero11
92 bahagian Cerita Lengkap
****Author's Note**** If you are reading this story on any other platform other than Wattpad, you are very likely to be at risk of a Malware attack. If you wish to read this story in it's original, safe form, please go to https://www.wattpad.com/story/257040916?utm_source=android&utm_medium=link&utm_content=share_writing&wp_page=create&wp_uname=JondZero11&wp_originator=3CdTAOyDZxOGCnstIx6HedcaklkX3yZ%2Fqtxk%2FPSSUcOcftReUGE5VxwimjZJVTYMzsd96L%2BljmtvKGnqp4MPEgMq9yuAjnOHZfXMu2azCyEsojaaLESEwguV4diqS5o3 Thank you and good day PLIAGARISM IS A CRIME!! ********************************************* Dalawang buwan ng bakasyon sa Isla ng Paradisio ang inaasam dapat ng mag-amang Archie (14 taon gulang) at si Arman (38 taong gulang) na malayo sa siyudad upang makapagpahinga at magliwaliw. Ngunit sila'y madadawit sa kaso ng hindi maipaliwanag na pagkawala ng ilang mga tao sa isla. Anu kaya ang dahilan ng pagkawala ng mga taong ito at kinahinatnan nila bago sila nawala? Anu din kaya ang magiging papel ng mag-ama sa kasong ito?
Branded Series Book 4: Jarine (COMPLETED) oleh BinibiningAbbott
34 bahagian Cerita Lengkap Matang
Sabi nila you can't control who you fall for. Pero pano kung na -fall ka sa taong feeling mo ay hindi karapat-dapat para sa'yo? Kasi alam mong may mali sa'yo. Hanggang kailan mo kayang pigilan ang iyong sarili kung nilalandi ka niya ng bongga? Susugal ka ba kahit alam mong may posibilidad na hindi ka niya matatanggap? *Jarine joined the group* 😂 WARNING: SPG Content/ R-18 Read at your own risk. May mga kahalayan po ang kuwentong ito, sorry na agad. I'm a trying hard writer so please bare with me sa lahat ng errors. This is my first time writing, lalo na ng SPG thingy, so kung hindi man kayo ma-satisfy, I apologize in advance. Masyado pa kasi akong inosente sa mga ganyan (chos). There might be some typo and grammatical errors since I'm only human, nagkakamali din, and I'm not really good in english. Feel free to correct me po. Para maitama ko naman ang aking pagkakamali. Thank you so much 😘 XOXO
Sana Ako Na Lang oleh Angels_Knight_15
9 bahagian Cerita Lengkap
Sana makita mo naman na may nagmamahal sayo..... Nasa malayo at nakatingin sayo.... At minsan na..... Nakakasama mo.... Nung Ikaw ang lumayo.... Ako naman ang patuloy na sumusunod sayo... Tinitignan ko ang bawat kilos mo... Na minsang nagpaparamdam sayo ng wala kang kamalay malay. At ito ang nagpapangiti sayo..... Ngiti na nagpapaligaya sa akin ng lubusan....... Peroo...... Bakit pag kaharap mo na ko hindi mo na ko makita??? Bakit sa kanya ka laging nakatingin?? Bakit hindi mo man lang ako bigyang pansin? Di ba siya ang nagpapaluha sayo?? Bakit pinagpipilitan mo pa ang sarili mo? Nandito naman ako....... Palaging nakatingin at nakasunod sayo. Sana ako na lang..... Pero hanggang 'SANA' lang naman ako... (A/N: if your a perfectionist this story is not for you po. Maraming kahugutan ang nilalaman ng diary be like story po na ito. Yung tipong nagpapakat@nga na po yung mga characters di pa rin makapag move on yung kahit lumayo na sila no use pa rin po. Kung hindi mo po type yung mga gantong scenes wag niyo na lang pong basahin baka maboring lang po kayo or mainis. Pero sana naman po pansinin at suportahan nyo. And lastly feel free to write a comment about what you can say about the recent chapter that you had read. That's all thank you po.)
The Rose: Mistaken Identity (Book 1 of THE ROSE Pentalogy) COMPLETED oleh Emill_Lia
103 bahagian Cerita Lengkap
Hello Roses! After a three year hiatus, I am finally back! To the readers of The Rose, I apologize for the not updating the story for a long time - really long time. I was busy at work and school, and so I had to postpone updating it. A family member of mine encouraged me to continue writing the story. She was delighted to see the positive comments you guys left, and no one appreciates it more than I do. It truly makes me happy! Now, I promise you that I will keep you updated with fresh chapters every week to keep the story going. I re-read the entire story, and I found out that there are a lot of things to improve(grammar, scenarios, plot), and so I decided to edit the entire story starting from the very beginning(this occupied most of my time). Yes, please feel free to re-read the story from the very beginning because a lot of scenarios were added for your convenience! :) I apologize in advance to the readers for the grammar/spelling/typo mistakes. No excuses, I am obviously not an expert! However, please feel free to message me for the corrections anytime, and I would gladly edit it. Lastly, napansin niyo siguro - bakit parang ang tagal magka-developan nung mga bida? At bakit ang dami nilang dialogues together? Well, that is because I want the lead characters to create a memorable time together. You will figure out what I mean as you read along . And most importantly, I want to highlight how a normal conversation between two people are - that it is not fast paced, and a lot of things really do happen in a day. :) That's it for now! Please enjoy it, and let's make magic! ;) For Book 2 of The Rose, kindly click on the link: https://www.wattpad.com/313442036-the-rose-a-withered-petal-book-2-of-the-rose
Lumuluhang Puso at Tumitibok na Luha oleh VanzLorica
18 bahagian Cerita Lengkap Matang
Sabi nila huwag ka daw magmadali pagdating sa pag-ibig. Marunong ka daw dapat maghintay ng Tamang Panahon. Sabi nila yun kaya yun ang tumatak sa isip ko sa tuwing magkakaroon ako ng paghanga sa isang tao. Pero paano kung sa kakahintay mo ay bigla siyang dumating sa buhay mo ng maaga? Di ba't nakapagtataka? Nadadalawang isip ka kung siya na nga o hindi pa. Tanong? Handa ka ba sa anumang mangyayari? May sapat ka na bang armas at panangga sa sakit na mararamdaman mo kung sakali? Haba ng Description hahahaha xD de 'joke... (Mahaba daw xD) Ito nga pala ang kwento ng aking isang kaibigan sa loob ng isa kong katauhan hahaha xDD Ang katauhan ko pagdating sa Pag-ibig. Sana masiyahan kayo sa istorya ko.. Gagawin kong malamig ang summer niyo bwahahahahaha xDD Hit Like, Comment and Vote para masaya ang summer niyo este natin pala hahha xD #Coke(ShareTheHappiness) #cLvNz04
ALONGSIDE YOU (Royalty Series #2) oleh KwinYen
67 bahagian Cerita Lengkap Matang
SHE WAS HUMILIATED BY HER CRUSH "I'm sorry, but I don't want a conservative girls like you to become a part of my collections. I admit your beauty is impressively and extremely different from my women in bed. Pero yung mga katulad mo ang matatawag kong boring sa kama. Palagay ko rin ay hindi ka papasa sa mga ipapagawa ko sayo. I'm dominant when it comes to s*x. Pero kung ipagpipilitan mong karapat-dapat kitang pag-aksayahan ng oras, you can beg. Kneel before me and beg for my pleasure." BUT SHE FOUND A NEW FRIEND "Hi! I'm Zill. Sorry for eavesdropping, I just can't take it lalo't pinapahiya ka na nya." "I'm Kelsey." Pakilala ko. "Ooy! Ooy! Ano bang meron sa araw na'to? Halos lahat yata ng naggagandahang babae lumalapit sa'kin? Haha. Sorry girls pero may date ako ngayon." Mayabang na sabi nito. "HAHAHA! You're kidding, right?" Natatawang insultong tanong ni Zill. "Ako? Magkakagusto sayo? Excuse me, pero yang mukha mo, wala pa sa kalingkingan ng kakambal ko. Ano bang pinagmamalaki mo? Ang kayabangan ng dila mo? O ang mukha mo na hindi ko naman alam kung dapat ba talagang ipagmalaki?" SHE WAS BETRAYED BY HER BESTFRIEND "K-kelsey? L-let me e-explain." Natatarantang sabi ni Rachel. SHE WAS NEARLY RAPED BY SOME DRUNKARD "Haha! Ang galing natin tsumamba!" Sabi nung lalakeng nasa kaliwa ko. Hinawakan naman kaagad ng isang lalake ang magkabilang kamay ko at inilagay iyon sa likod. I'm screwed up.. BUT AT THE END OF THE DAY, SHE FOUND A NEW LIGHT... "Tss!" Singhal nya. "Hey! Woman, I couldn't care less about your naked body. But this is my territory. I'm preventing any crime and maintaining the peace and order within my premises. If you want to experience the same thing again without my help, you can leave inside my domain." He coldly said. Napansin ko lalo ang sobrang gwapong mukha nya. He's beyond perfection. I can't compare him to just anybody else. Like I didn't know na nag-eexist ang mga ganitong mukha sa mundo. She is KAYE ANTHEA KELSEY ALONSO.
Bisexuals Academy ( Bisexual Students Allowed) oleh charlesduquevlogs
18 bahagian Cerita Lengkap
DICLAIMER: All the characters in this story have no existence whatsoever outside the imagination of the author. They are not even distantly inspired by any individual known and unknown to the author, and all the incidents are merely invention. REMEMBER: 1. Masungit si Author😬😬😬 2. Mag-update lamang po ako kung may free time. 3. Like/comment before update. (charossss! joke lang. Kahit silent reader ka, I appriciated you, Guys!) /Ito po ay ang pangalawang storya na aking ihahandong sa inyo. Kahit na po ito ay pangalawa na, hindi ko po pa rin maiiwasan ang words error ng story. Nawa'y sa pagkakataong iyan ay ikorek niyo na lang po ako. (salamat) Sa mga kamalihan ko o sa mga sentence na hindi ko naibibigay kong sino na po ang nagsasalita noon o may POV, nawa'y patawarin niyo ako. Ang intensyon ko lamang po ay i-inspired kayo sa mga istoryang aking ginagawa at para turuhan kayo na ikorek ang pagkakamali. Is I'm right? woss! Oh heto na, dami ng dada ng Author niyo . ツB L A C K P E I N
Back To You [Completed] oleh Emvrios
44 bahagian Cerita Lengkap Matang
"Just let me see our son and I'll leave..." pagmamakaawa niya sa akin. "No! Wala kang karapatan so leave! Not just here, pati sa buhay ko!" Sigaw kong muli. "Bella, I beg you, I want to see our son..." "Anak mo mukha mo! Wala kang anak! Magmula nang iwan mo ako, kami, wala ka nang anak at wala ka nang Bella!" Marahas kong hinila ang mga kamay ko sakaniya. I saw his tears drop and I don't care! I'm pregnant and my parents kicked us out of our house the moment they knew that I have a kid in my stomach. I don't know what to do! I'm just a kid and helpless! I don't have my own job yet because I still go to school! Napabalikwas ako ng tayo dahil sa bangungot na 'yon. Ako? Mabubuntis? I don't even know that man I was pushing away on that dream because of his blurry face. "Bangungot lang 'yon Bella..." I tried to calm myself. Bumalik ako sa tulog dahil madaling araw pa naman. I have to review my lessong because next week is our examination week. And this week came, it's stressing me out so bad. Ni hindi ko na mapagtuunan ng pansin ang crush ko dahil sa pagrereview. Sobrang stress namin ni Pierre sa exams at talagang kulang kami lagi sa tulog. And thank God for keeping us alive hanggang sa matapos ang exams namin. All we have to do is to eait for the results which is next week also. Buti na lang hindi ako inaantala ng masamamg panaginip ko noong exams ko. Who was that? And how?
You may also like
Slide 1 of 10
I'm In Love With Ms. Author (GirlxGirl) COMPLETED cover
Bittersweet Hearts cover
Ang Misteryosong Kaso Ng Pagkawala Sa Isla Paradisio (Book 1) cover
Branded Series Book 4: Jarine (COMPLETED) cover
Sana Ako Na Lang cover
The Rose: Mistaken Identity (Book 1 of THE ROSE Pentalogy) COMPLETED cover
Lumuluhang Puso at Tumitibok na Luha cover
ALONGSIDE YOU (Royalty Series #2) cover
Bisexuals Academy ( Bisexual Students Allowed) cover
Back To You [Completed] cover

I'm In Love With Ms. Author (GirlxGirl) COMPLETED

39 bahagian Cerita Lengkap Matang

It all started with a 'Hi Miss!' Until followed by many messages that until now I still do not reply. "Ms. Author, kumain kana?" "Ms. Author, ingat sa buong araw ha, mamahalin pa kita." "Ms. Sing ganda ng mga libro mo ang magiging love story natin." "Ms. Huwag ng tumingin sa iba ha, baka tuluyan kang madapa at mahulog....sakin." "Ms. I'll introduce myself to you soon so just wait, okay?" "By the way, I'm your future wife." --- Like, who the hell is she?! Pina-prank lang ba ako nito?! For almost a year? Wala ba siyang ibang magawa sa araw-araw? Ang lala yata ng tama sa utak kaya napakalakas din ng trip sa buhay. Every day, I always wonder who this woman really is. She's obviously one of my readers. And the annoying thing is, I think my brain cells are running out of thoughts of why she had to send me nonsense messages every day. Argh! So I hired a private investigator to find her. I want her to stop as soon as possible because if she doesn't.... I might end up falling for her. AND THIS IS ALL HER FAULT!!

Maklumat lanjut