Story cover for CELYN MARQUEZA by Marivlind
CELYN MARQUEZA
Marivlind
  • WpView
    Leituras 156
  • WpVote
    Votos 22
  • WpPart
    Capítulos 11
  • WpView
    Leituras 156
  • WpVote
    Votos 22
  • WpPart
    Capítulos 11
Marivlind
Em andamento, Primeira publicação em mai 02, 2019
accidentadventurebarriobillionairefamilyfreakfriendshipgirlhighschoolhothumorkidnappedlostprobinsyarichromancesummerromancethecallalilyawardsthriller
"Oh my God Celyn, drive faster!"

"I know! That's what I'm doing."

I don't know why they are following us, but I'm pretty sure they want us. Maybe, to kidnapped us and call our parents for a ransom money.

For the past years hindi mawalawala ang ganitong scenario. Lalabas kalang sandali sa bahay may sumusunod na sayo.

Sa apelyidong nakatatak sayo paniguradong mangayayari talaga yan sayo. I felt so tired of this scene and now it is happening again at nataon pang walang guards na nakaalalay at nagbabantay sayo.

Running and saving our freaking lives is what I've never expected. I'm just having my summer vacation and this is what happens?

"Celyn faster!!"

"Shut up George!!"

I drive faster just to be away of those jerks. Hindi ko na alam kung saang lugar na ito basta makalayo lang kami sa kanila. I just hope our buttler's will find us as soon as possible.

"CELYN WATCH OUT!!"

When i look what George was pointing I immediately turn the car to my right but I didn't expect na bangin pala iyon. 

"P-please sa-save us..."
Todos os Direitos Reservados
accidentadventurebarriobillionairefamilyfreakfriendshipgirlhighschoolhothumorkidnappedlostprobinsyarichromancesummerromancethecallalilyawardsthriller
Índice

11 capítulos

Inscreva-se para adicionar CELYN MARQUEZA à sua biblioteca e receber atualizações
ou
#678girl
Diretrizes de Conteúdo
Talvez você também goste
Sweetest Mistake, de iamwanna29
33 capítulos Concluída Maduro
Alam mo 'yung feeling na wala ka namang ginagawang masama, pero parang pinagtitripan ka ng universe? Yung tipong isang maling liko mo lang, biglang ang daming domino effect na sumasabog sa mukha mo? Gano'n ang ganap sa buhay ko. Once upon a time, I was just an average girl-well, not-so-average dahil certified independent woman tayo, mga besh. I had a decent job, a stable life, and a heart that was very much closed for renovation. Bakit? Kasi my ex-boyfriend ghosted me. As in, bigla na lang nawala, walang pasabi, walang closure, walang anything. Eh di syempre, bilang matinong babae, I did what any rational human being would do-nag-move on nang slight. Pero 'di ko akalain na sa kagustuhan kong iwasan ang lalaking sinaktan ako, biglang may ibang lalaki namang ipapatapon sa buhay ko ang tadhana. At saang lugar pa? Sa isang hotel room. With a stranger. At hindi lang basta-bastang lalaki, kundi isang nakakagigil na tao na later on, malalaman kong magiging bagong boss ko. Yes. Alam kong wala akong luck sa love life, pero bakit pati sa career, pinaglalaruan ako ng tadhana? This is the story of how one mistake-one embarrassing, nakakahiya, and downright WORST moment of my life-turned into something I never expected. Welcome to my Sweetest Mistake
The Rose: Mistaken Identity (Book 1 of THE ROSE Pentalogy) COMPLETED, de Emill_Lia
103 capítulos Concluída
Hello Roses! After a three year hiatus, I am finally back! To the readers of The Rose, I apologize for the not updating the story for a long time - really long time. I was busy at work and school, and so I had to postpone updating it. A family member of mine encouraged me to continue writing the story. She was delighted to see the positive comments you guys left, and no one appreciates it more than I do. It truly makes me happy! Now, I promise you that I will keep you updated with fresh chapters every week to keep the story going. I re-read the entire story, and I found out that there are a lot of things to improve(grammar, scenarios, plot), and so I decided to edit the entire story starting from the very beginning(this occupied most of my time). Yes, please feel free to re-read the story from the very beginning because a lot of scenarios were added for your convenience! :) I apologize in advance to the readers for the grammar/spelling/typo mistakes. No excuses, I am obviously not an expert! However, please feel free to message me for the corrections anytime, and I would gladly edit it. Lastly, napansin niyo siguro - bakit parang ang tagal magka-developan nung mga bida? At bakit ang dami nilang dialogues together? Well, that is because I want the lead characters to create a memorable time together. You will figure out what I mean as you read along . And most importantly, I want to highlight how a normal conversation between two people are - that it is not fast paced, and a lot of things really do happen in a day. :) That's it for now! Please enjoy it, and let's make magic! ;) For Book 2 of The Rose, kindly click on the link: https://www.wattpad.com/313442036-the-rose-a-withered-petal-book-2-of-the-rose
ES-2 (Rain) , de Jahmcrisian9189
24 capítulos Concluída Maduro
"Itigil ang kasal...!!!!" I heard the familiar voice inside the church, it's crazy you know we just meet and talk a few hours ago and now I even recognize her voice. I don't know what gotten in me that I walk inside the church and there I saw the girl She was standing at the middle of the beautiful decorated isles, she was about to cry but she was trying hard to hold her tears. "Alicia..what are you doing?" I saw the groom and the bride was shock, people are whispering around. "Kito, diba ako naman ang mahal mo? Diba? bakit? Bakit ganito? Bakit Michelle?" her tears are already on the verge of falling, "Alicia, you couldn't understand? kahit kailan di na ako babalik sayo kahit mamatay pa ako" I heard the groom said, damn! too much drama, "Peru mahal na mahal kita Kito..sobra kitang mahal" she suddenly wailed hard, she sounds like a slaughtered cow! I walk to the girl and hold her hand nakita ko pang nagulat siya na nakita niya ako, well I am more even surprise myself why I am doing this. "Let's go" I said as people continue to murmur around us. "Peru...Kito.." I clearly heard the desperate tone of her calling, damn! this things people can do for love "Let's go Alicia" I firmly said before I started to walk outside holding her hand tightly, she seems reluctant at first as she made a final glance to the couple. Damn this thing called love! *This story is pure fiction anything that resembles in reality is not intended by the author* *There are a lot of grammatical errors, construction errors ahead I will advance my apology*
Objection, Your Honor! I'm the Villainess?!, de MoonSeen
65 capítulos Em andamento
I used to be the undefeated queen of the courtroom-Alexis Reyes, the baddest, sassiest, most feared lawyer sa buong Pilipinas. Walang kaso na hindi ko napanalunan. Until... BAM! I woke up sa isang romantic harem novel. And guess what? Ako yung kontrabida. Oo, ako si Celestine Alcantara-heiress ng Alcantara Medical Empire, mayaman, glam, at certified mean girl. Kalaban ko? Yung so-called mabait at pure-hearted female lead, si Liana Cruz. She's the adoptive daughter of the CEO ng rival hospital chain. Pero teka, bakit ako ang mas relateable? Bakit parang ako yung pinagtutulungan ng universe? To make things worse, and by worse I mean juicy... I'm surrounded by four walking red flags: - A cold but dangerously hot CEO na may hidden soft side. - A smug hotshot lawyer na parang version ko sa OG world. - A charming doctor na mas makinis pa sa baby oil. - At isang sexy celebrity chef na laging may pa-sweet na pagkain... and kilig. They're all supposedly in love with Liana. Pero bakit parang ako ang binibigyan ng screen time ngayon? Plot twist ba 'to o character development? Now I have two choices: follow the script and face my "tragic" ending... or rewrite the story, make them fall for me, and prove na kahit villainess ako, I slay-with or without a gavel. This is not your typical love story. This is my cross-examination with fate. Game ka na ba, Your Honor?
Lumuluhang Puso at Tumitibok na Luha, de VanzLorica
18 capítulos Concluída Maduro
Sabi nila huwag ka daw magmadali pagdating sa pag-ibig. Marunong ka daw dapat maghintay ng Tamang Panahon. Sabi nila yun kaya yun ang tumatak sa isip ko sa tuwing magkakaroon ako ng paghanga sa isang tao. Pero paano kung sa kakahintay mo ay bigla siyang dumating sa buhay mo ng maaga? Di ba't nakapagtataka? Nadadalawang isip ka kung siya na nga o hindi pa. Tanong? Handa ka ba sa anumang mangyayari? May sapat ka na bang armas at panangga sa sakit na mararamdaman mo kung sakali? Haba ng Description hahahaha xD de 'joke... (Mahaba daw xD) Ito nga pala ang kwento ng aking isang kaibigan sa loob ng isa kong katauhan hahaha xDD Ang katauhan ko pagdating sa Pag-ibig. Sana masiyahan kayo sa istorya ko.. Gagawin kong malamig ang summer niyo bwahahahahaha xDD Hit Like, Comment and Vote para masaya ang summer niyo este natin pala hahha xD #Coke(ShareTheHappiness) #cLvNz04
ALONGSIDE YOU (Royalty Series #2), de KwinYen
67 capítulos Concluída Maduro
SHE WAS HUMILIATED BY HER CRUSH "I'm sorry, but I don't want a conservative girls like you to become a part of my collections. I admit your beauty is impressively and extremely different from my women in bed. Pero yung mga katulad mo ang matatawag kong boring sa kama. Palagay ko rin ay hindi ka papasa sa mga ipapagawa ko sayo. I'm dominant when it comes to s*x. Pero kung ipagpipilitan mong karapat-dapat kitang pag-aksayahan ng oras, you can beg. Kneel before me and beg for my pleasure." BUT SHE FOUND A NEW FRIEND "Hi! I'm Zill. Sorry for eavesdropping, I just can't take it lalo't pinapahiya ka na nya." "I'm Kelsey." Pakilala ko. "Ooy! Ooy! Ano bang meron sa araw na'to? Halos lahat yata ng naggagandahang babae lumalapit sa'kin? Haha. Sorry girls pero may date ako ngayon." Mayabang na sabi nito. "HAHAHA! You're kidding, right?" Natatawang insultong tanong ni Zill. "Ako? Magkakagusto sayo? Excuse me, pero yang mukha mo, wala pa sa kalingkingan ng kakambal ko. Ano bang pinagmamalaki mo? Ang kayabangan ng dila mo? O ang mukha mo na hindi ko naman alam kung dapat ba talagang ipagmalaki?" SHE WAS BETRAYED BY HER BESTFRIEND "K-kelsey? L-let me e-explain." Natatarantang sabi ni Rachel. SHE WAS NEARLY RAPED BY SOME DRUNKARD "Haha! Ang galing natin tsumamba!" Sabi nung lalakeng nasa kaliwa ko. Hinawakan naman kaagad ng isang lalake ang magkabilang kamay ko at inilagay iyon sa likod. I'm screwed up.. BUT AT THE END OF THE DAY, SHE FOUND A NEW LIGHT... "Tss!" Singhal nya. "Hey! Woman, I couldn't care less about your naked body. But this is my territory. I'm preventing any crime and maintaining the peace and order within my premises. If you want to experience the same thing again without my help, you can leave inside my domain." He coldly said. Napansin ko lalo ang sobrang gwapong mukha nya. He's beyond perfection. I can't compare him to just anybody else. Like I didn't know na nag-eexist ang mga ganitong mukha sa mundo. She is KAYE ANTHEA KELSEY ALONSO.
Ang Misteryosong Kaso Ng Pagkawala Sa Isla Paradisio (Book 1), de JondZero11
92 capítulos Concluída
****Author's Note**** If you are reading this story on any other platform other than Wattpad, you are very likely to be at risk of a Malware attack. If you wish to read this story in it's original, safe form, please go to https://www.wattpad.com/story/257040916?utm_source=android&utm_medium=link&utm_content=share_writing&wp_page=create&wp_uname=JondZero11&wp_originator=3CdTAOyDZxOGCnstIx6HedcaklkX3yZ%2Fqtxk%2FPSSUcOcftReUGE5VxwimjZJVTYMzsd96L%2BljmtvKGnqp4MPEgMq9yuAjnOHZfXMu2azCyEsojaaLESEwguV4diqS5o3 Thank you and good day PLIAGARISM IS A CRIME!! ********************************************* Dalawang buwan ng bakasyon sa Isla ng Paradisio ang inaasam dapat ng mag-amang Archie (14 taon gulang) at si Arman (38 taong gulang) na malayo sa siyudad upang makapagpahinga at magliwaliw. Ngunit sila'y madadawit sa kaso ng hindi maipaliwanag na pagkawala ng ilang mga tao sa isla. Anu kaya ang dahilan ng pagkawala ng mga taong ito at kinahinatnan nila bago sila nawala? Anu din kaya ang magiging papel ng mag-ama sa kasong ito?
Sana Ako Na Lang , de Angels_Knight_15
9 capítulos Concluída
Sana makita mo naman na may nagmamahal sayo..... Nasa malayo at nakatingin sayo.... At minsan na..... Nakakasama mo.... Nung Ikaw ang lumayo.... Ako naman ang patuloy na sumusunod sayo... Tinitignan ko ang bawat kilos mo... Na minsang nagpaparamdam sayo ng wala kang kamalay malay. At ito ang nagpapangiti sayo..... Ngiti na nagpapaligaya sa akin ng lubusan....... Peroo...... Bakit pag kaharap mo na ko hindi mo na ko makita??? Bakit sa kanya ka laging nakatingin?? Bakit hindi mo man lang ako bigyang pansin? Di ba siya ang nagpapaluha sayo?? Bakit pinagpipilitan mo pa ang sarili mo? Nandito naman ako....... Palaging nakatingin at nakasunod sayo. Sana ako na lang..... Pero hanggang 'SANA' lang naman ako... (A/N: if your a perfectionist this story is not for you po. Maraming kahugutan ang nilalaman ng diary be like story po na ito. Yung tipong nagpapakat@nga na po yung mga characters di pa rin makapag move on yung kahit lumayo na sila no use pa rin po. Kung hindi mo po type yung mga gantong scenes wag niyo na lang pong basahin baka maboring lang po kayo or mainis. Pero sana naman po pansinin at suportahan nyo. And lastly feel free to write a comment about what you can say about the recent chapter that you had read. That's all thank you po.)
LIES AND TRUTH (ONE-SHOT STORY), de FoxyFridz
1 capítulo Concluída
“NOOOOOOOOOOOO!” Malakas na sigaw ng isang dalaga. Dinig na dinig ang boses nito sa buong kabahayan sa lakas ng pagkakasigaw nito na nagmumula sa may study room. “Calm down Collette. Why are you screaming at your father?” anang ginoo na ama ng dalaga. “You want me to calm down? You want me to CALM DOWN? For goodness sake dad, how can I calm down when you want me to marry a stranger all of a sudden? Dad, this is insane!” histerikal na wika ng dalaga. “Hija, Axel is a good guy. And I know he will be a responsible husband for you. He’s smart, handsome and rich. He can help you manage our business when I’m gone.” Anang kanyang ama. “And he is your childhood friend before his family migrated abroad. Hindi mo na ba siya natatandaan. “No! You cannot drag me into this foolishness of yours!” ani Collette. “Hindi ko siya natatandaan at kung matandaan ko man siya, di ko pa rin siya pakakasalan.” at tumayo na para iwan ang kanyang ama. Collete couldn't understand her father for bringing up that arranged marriage all of a sudden. Axel is part of his past and she already buried his memories together with their friendship. Kaya naman hindi niya maintindihan kung bakit bigla na lang itong susulpot sa buhay niya at gusto siyang pakasalan. She needs to find a way to escape at ang tanging paraan na naisip niya eh ang tumakas at manirahan sa isang pribadong isla na pagmamay-ari ng dati niyang manliligaw. But what if destiny steps in and she meet someone she would fall for? Will she go for it to revenge with her father or will karma walks in?
Rhythm of Love (GXG) ON HOLD, de Moon_viewwww
64 capítulos Em andamento
In order to achieve each other's goal, they were stuck in one situation where both of them can't run. "Don't tell me I'll marry her for me to be able to hold that position?!" "Arden, that's my only condition for you... Take it or leave it." Napakuyom ang kamao ko. That position is very important to me, I don't care if I'll marry her to get that. What matters to me now is for me to secure that position for my self. "Avery, I told you, Jimenez company is already big so why do you need to step out just to make your own brand?" "Lo! I want to create something for myself. Ito lang naman ang hinihingi ko sa iyo eh!" I saw my lolo shrugged his shoulder. "Do you really want to do that?" "I'll do anything you'll ask me to do, just let me do what I really want lo.." Even if I'm nervous now, I am willing to swallow all my pride just for me to have that freedom which I longed to have. "Do you know Doctor Arden?" I furrowed my brows because of his question. "The next inline heirs of Lionel's Hospital? I know her why?" She's the arrogant doctor that I met before! The very cold and unfriendly doctor! Until now I can still sense the annoyance in my veins just hearing her name. "I'll give you the freedom you like if you'll marry her." WHAT?!!!
Talvez você também goste
Slide 1 of 10
Sweetest Mistake cover
The Rose: Mistaken Identity (Book 1 of THE ROSE Pentalogy) COMPLETED cover
ES-2 (Rain) cover
Objection, Your Honor! I'm the Villainess?! cover
Lumuluhang Puso at Tumitibok na Luha cover
ALONGSIDE YOU (Royalty Series #2) cover
Ang Misteryosong Kaso Ng Pagkawala Sa Isla Paradisio (Book 1) cover
Sana Ako Na Lang cover
LIES AND TRUTH (ONE-SHOT STORY) cover
Rhythm of Love (GXG) ON HOLD cover

Sweetest Mistake

33 capítulos Concluída Maduro

Alam mo 'yung feeling na wala ka namang ginagawang masama, pero parang pinagtitripan ka ng universe? Yung tipong isang maling liko mo lang, biglang ang daming domino effect na sumasabog sa mukha mo? Gano'n ang ganap sa buhay ko. Once upon a time, I was just an average girl-well, not-so-average dahil certified independent woman tayo, mga besh. I had a decent job, a stable life, and a heart that was very much closed for renovation. Bakit? Kasi my ex-boyfriend ghosted me. As in, bigla na lang nawala, walang pasabi, walang closure, walang anything. Eh di syempre, bilang matinong babae, I did what any rational human being would do-nag-move on nang slight. Pero 'di ko akalain na sa kagustuhan kong iwasan ang lalaking sinaktan ako, biglang may ibang lalaki namang ipapatapon sa buhay ko ang tadhana. At saang lugar pa? Sa isang hotel room. With a stranger. At hindi lang basta-bastang lalaki, kundi isang nakakagigil na tao na later on, malalaman kong magiging bagong boss ko. Yes. Alam kong wala akong luck sa love life, pero bakit pati sa career, pinaglalaruan ako ng tadhana? This is the story of how one mistake-one embarrassing, nakakahiya, and downright WORST moment of my life-turned into something I never expected. Welcome to my Sweetest Mistake

Mais detalhes