Story cover for Unknown Lady by SweetDevilishAngel
Unknown Lady
SweetDevilishAngel
  • WpView
    Reads 53,603
  • WpVote
    Votes 1,700
  • WpPart
    Parts 45
  • WpView
    Reads 53,603
  • WpVote
    Votes 1,700
  • WpPart
    Parts 45
SweetDevilishAngel
Complete, First published May 06, 2019
Mature
bampiraconfusingconnectioncursefantasygoddessesgodshiddenidentityloveteamsmatesrom-comroyalfamilysweetdevilisangelthrillervampirewerewolfwinterwitchesziatryleempire
In Hexelio World, Vampires have their own myths. They are not allowed to disobey the Goddess of Love, who is assigned to mate them with someone. But even though they are with their 'beloved', their minds is not at peace, their heart is aching. And that is confusing as hell.

And as this Unknown Lady came, she will put everyone into deep confusion, in a great turmoil.

She is not a Vampire nor a hybrid, she is an Unknown Lady came from rare breed.





Disclaimer: This story is writen in Taglish. Cover picture is not mine. Credits to the rightful owner.
All Rights Reserved
bampiraconfusingconnectioncursefantasygoddessesgodshiddenidentityloveteamsmatesrom-comroyalfamilysweetdevilisangelthrillervampirewerewolfwinterwitchesziatryleempire
Table of contents

45 parts

Sign up to add Unknown Lady to your library and receive updates
or
Content Guidelines
You may also like
The Crystal Academy:The Lost Princess by Princess_Quennie
38 parts Complete
Do you believe that IMMORTAL exist? Vampire,Werewolf,Fairies and others? Well,This story is about Immortality. They are called CRYSTALIAN because they live in the Crystal World where only the Goddess of the Crystal can save Want to know about the story? Then come and explore the Crystal Academy inside in the Crystal World Writer's Note: Hi guys,it's my first story. Hope you'll like it
Her Divine Lover by ZioneMyrtle
33 parts Complete Mature
[Taglish Story] - ACCURSED IV The Sovereign have set out detailed rules to maintain the balance of everything. It's within the book "Sovereign's Code" known by Gods and all kinds of immortals. On the other hand, the mortals are unaware of this rule. They are kept out of many things of the real truth, even of their own world. One certain being, however performed feats that took a God's attention. She has done a forbidden spell, one that may threaten the order of the world. In return for that, the God began to collect her debt. Her talents may even be of greater feats, so the Primordial God decided to take one of her children. However, taking them means separating them from their mates. The only daughter, Caia Zion Ivanov, however can't bear that to happen to her brothers. She has nothing aside from her family. She do not long for anyone. "I present myself," she said. That time, an equivalent exhange has been done. ================================== Started: March 10, 2023 Finished: May 17, 2025 Don't plagiarize!
The Dark Cold Blooded Keeper (BOOK II) by UnnamedKnight
39 parts Complete Mature
Life is not a dream, it is a journey for a keeper like Crimson, who lived in the highest peak of the sacred mountain, called, the Bloody Mountain. Where all you can see were crimson red color from the ground to the tree and to it's leaves. Even the wild animals, their eyes were glowing red. The streams of water are also red as blood just like the blood of the keeper, the owner of the mountain.
SHERLOCK HOLMES- The Sign Of The Four by ARTHUR CONAN DOYLE by Ikam_Atago
12 parts Complete
link: http://sherlock-holm.es/stories/html/cano.html# DISCLAIMER: I don't own anything in this story. I give the credit to the Author of this story CONAN DOYLE. By entering this site, you declare and affirm under the penalties of perjury that you are not a minor nor in the company of a minor and that accessing this site is not unlawful in your local area. You are entering this site of your own free volition and the owner of it accepts no responsibility for any individual's experience within. User agrees that he or she will hold Wattpad and GodessofLOVE harmless from all claims that may arise or result from any link to or content found on this domain. Furthermore, the user agrees that GodessofLove cannot be held responsible for any damage, claims or any mishaps that may happen to occur from any link leading outside this site. User also agrees that all poetry, literature and content is under full copyright protection by their rightful owner, which falls under the 1976 Copyright Act (title 17, U.S. Code). Any copyrighted content cannot be re-used, re-posted in any way or form. Any author who posts their literature of any type falls automatically under the Copyright Act 17, making his literature copyrighted by him. Therefore, no one is allowed to re-use any form of literature, poetry, short stories in any way. The user understands that violating these rules of copyright can lead to legal prosecution in the court of law under the copyright act 17. By this statment, you enter the site at your own responsibility. no copyright infringement intended.
ACE OF VAMPIRE by Hmaestories
17 parts Complete Mature
She was a Vampire Hunter. She's popular because of her powerful aura. She's not an ordinary people. She has a rare ability. Everyone known her because She's an Ace Huntress. The most powerful agent of God-believer. The most beautiful girl with a very long waivy golden hair. With a white-smooth skin. A talented, kind, lovely, charming girl namely Hershey Mae Mendoza. The Vampire Hunter Leader of a well known organization known as Deck Of Cards or the SILVER CROSS. As an Ace She has a difficult obligation to their own hometown, She needs to follow the request of the Prime---Highest Council in Britannia. To kill the most dangerous Vampire.. ----> A Crown Prince He has a cold aura that freeze you to death. He's mysterious, arrogant, loner and a bit rude. He's famous because of being a Crown Prince. A Royal blood Vampire who can rule the world. He has a powerful mage. Every girl dream of having him. His so handsome in every way. That's why any girls in their hometown love him. Want him. But all of them are afraid of him because of his own magical power. Then its start with this :) Hope you'll enjoy. Don't forget to votes, comments and support this story. Thank you
The Last Vampire Prince COMPLETED (Tagalog) by BookDreamer12
55 parts Complete
Milka Claire Fuentes, the lady who accidentally heard the true identity of her famous schoolmate Zacharious, on the rooftop . And Because of the unintended circumstances she would be compelled to be in the agreement in exchange for the salvation of her loved ones by choosing it in one of the three choices; First: Her death Second: Be a vampire Third: Marry him What is she going to do now?
Claiming The Forbidden (On Going) by LiolaPhantom
9 parts Ongoing Mature
Harmonica, daughter of the Alpha King but despite being the child of a strong Alpha she was born wolfless. She is a weak wolf. That's why she is kept protected all her life. But what will happen when their sworn enemy invited them into his castle to talk about the treaty of both kingdom? Harmonica was so excited to hear the news but later regret when the Vampire King doesn't want to have peace at all. And now he's starting it with a dirty game that turns out to be the starting point of their own destiny. __________ Can a Forbidden Love conquer all the uncertainties that awaits them? __________ LiolaPhantom Date Started: 07-20-23 Date Ended:
Hide n Kill by StarnightEclipse
28 parts Complete Mature
Authors' Note This is a story about survival and strategy, about friendship and loyalty, about betrayal and sacrifice. The writing of this story has been a difficult task. We, the authors of this story, had to overcome numerous challenges before we were able to complete it and meet our expectations. This story is fiction and it was created from our vast imagination to provide readers with thrilling thrills and excitement. Scenarios in this story may be similar to those in other stories, but this is not done on purpose. We can't promise to give you all a perfect story because we aren't that experienced in making them and are still growing and learning along the way, but it will be worthwhile as long as we know we've given it our all. Thank you for all of the support and assistance that will be provided to us. We may not name you, but you are all deeply appreciated and remembered in our hearts. Thank you once more, and God bless you! Disclaimer: All names, places, characters, plot twists, and events are purely fictitious creations of the authors. If there is a resemblance, it is purely coincidental and not intended to be adopted. Copyright© All right reserved. No part of this book may be produced, distributed, or transmitted in any form or by any means, including printing, recording or other electronic or mechanical methods, without the prior written permission of the authors, except in the case of brief quotations embodied in critical reviews and certain other noncommercial uses permitted by copyright law. ALL RIGHTS RESERVED
Vampire Academy #1: Vampire Huntress {Complete} by samOyue
31 parts Complete Mature
A human vampire huntress with a taste of pure blood isn't extraordinary at all, but what if you find yourself completely held against your will? Copyright © 2013 by samoyue All rights reserved. This book or any portion thereof may not be reproduced or used in any manner whatsoever without the express written permission of the publisher except for the use of brief quotations in a book review.
Deceitful Desire (Fangs Series #1) by vintxgemystiq
32 parts Complete
Deixyree Aeliana Laveire couldn't believe that she was tied to a ruthless vampire and that she is the chosen key to put an end to the war of empires. Join her bloody quest in the vampire world as she fights for her freedom. NOTE: If you are sensitive to cruelty, violence and abusive action, don't read this. Save yourself from stress because mental health matters! DATE STARTED: 04-20-2021 DATE ENDED: 01-10-2025 LANGUAGE: TagLish (Tagalog x English).
You may also like
Slide 1 of 10
The Crystal Academy:The Lost Princess cover
Her Divine Lover cover
The Dark Cold Blooded Keeper (BOOK II) cover
SHERLOCK HOLMES- The Sign Of The Four by ARTHUR CONAN DOYLE cover
ACE OF VAMPIRE cover
The Last Vampire Prince COMPLETED (Tagalog) cover
Claiming The Forbidden (On Going) cover
Hide n Kill cover
Vampire Academy #1: Vampire Huntress {Complete} cover
Deceitful Desire (Fangs Series #1) cover

The Crystal Academy:The Lost Princess

38 parts Complete

Do you believe that IMMORTAL exist? Vampire,Werewolf,Fairies and others? Well,This story is about Immortality. They are called CRYSTALIAN because they live in the Crystal World where only the Goddess of the Crystal can save Want to know about the story? Then come and explore the Crystal Academy inside in the Crystal World Writer's Note: Hi guys,it's my first story. Hope you'll like it

More details