Story cover for Unknown Lady by SweetDevilishAngel
Unknown Lady
SweetDevilishAngel
  • WpView
    Reads 53,605
  • WpVote
    Votes 1,700
  • WpPart
    Parts 45
  • WpView
    Reads 53,605
  • WpVote
    Votes 1,700
  • WpPart
    Parts 45
SweetDevilishAngel
Complete, First published May 06, 2019
Mature
bampiraconfusingconnectioncursefantasygoddessesgodshiddenidentityloveteamsmatesrom-comroyalfamilysweetdevilisangelthrillervampirewerewolfwinterwitchesziatryleempire
In Hexelio World, Vampires have their own myths. They are not allowed to disobey the Goddess of Love, who is assigned to mate them with someone. But even though they are with their 'beloved', their minds is not at peace, their heart is aching. And that is confusing as hell.

And as this Unknown Lady came, she will put everyone into deep confusion, in a great turmoil.

She is not a Vampire nor a hybrid, she is an Unknown Lady came from rare breed.





Disclaimer: This story is writen in Taglish. Cover picture is not mine. Credits to the rightful owner.
All Rights Reserved
bampiraconfusingconnectioncursefantasygoddessesgodshiddenidentityloveteamsmatesrom-comroyalfamilysweetdevilisangelthrillervampirewerewolfwinterwitchesziatryleempire
Table of contents

45 parts

Sign up to add Unknown Lady to your library and receive updates
or
Content Guidelines
You may also like
Claiming The Forbidden (On Going) by LiolaPhantom
9 parts Ongoing Mature
Harmonica, daughter of the Alpha King but despite being the child of a strong Alpha she was born wolfless. She is a weak wolf. That's why she is kept protected all her life. But what will happen when their sworn enemy invited them into his castle to talk about the treaty of both kingdom? Harmonica was so excited to hear the news but later regret when the Vampire King doesn't want to have peace at all. And now he's starting it with a dirty game that turns out to be the starting point of their own destiny. __________ Can a Forbidden Love conquer all the uncertainties that awaits them? __________ LiolaPhantom Date Started: 07-20-23 Date Ended:
Her Divine Lover by ZioneMyrtle
33 parts Complete Mature
[Taglish Story] - ACCURSED IV The Sovereign have set out detailed rules to maintain the balance of everything. It's within the book "Sovereign's Code" known by Gods and all kinds of immortals. On the other hand, the mortals are unaware of this rule. They are kept out of many things of the real truth, even of their own world. One certain being, however performed feats that took a God's attention. She has done a forbidden spell, one that may threaten the order of the world. In return for that, the God began to collect her debt. Her talents may even be of greater feats, so the Primordial God decided to take one of her children. However, taking them means separating them from their mates. The only daughter, Caia Zion Ivanov, however can't bear that to happen to her brothers. She has nothing aside from her family. She do not long for anyone. "I present myself," she said. That time, an equivalent exhange has been done. ================================== Started: March 10, 2023 Finished: May 17, 2025 Don't plagiarize!
VAMPIRES WORLD by Airshineday
89 parts Complete
Three women were born with extraordinary abilities unlike any other. Rumors spread about the chaos in the world, caused by a growing vampire population that preyed on innocent humans, prompting fear among people who dared to venture out at night. Two cousins, with vampire blood coursing through their veins, struggled to integrate with humans due to their cold, violent nature. They harbored disdain for women, finding pleasure in inflicting pain upon them. Will their hearts change when they encounter women who might steal their hearts, or will they remain consumed by their violent nature, leaving a trail of innocent lives in their wake?
ACE OF VAMPIRE by Hmaestories
17 parts Complete Mature
She was a Vampire Hunter. She's popular because of her powerful aura. She's not an ordinary people. She has a rare ability. Everyone known her because She's an Ace Huntress. The most powerful agent of God-believer. The most beautiful girl with a very long waivy golden hair. With a white-smooth skin. A talented, kind, lovely, charming girl namely Hershey Mae Mendoza. The Vampire Hunter Leader of a well known organization known as Deck Of Cards or the SILVER CROSS. As an Ace She has a difficult obligation to their own hometown, She needs to follow the request of the Prime---Highest Council in Britannia. To kill the most dangerous Vampire.. ----> A Crown Prince He has a cold aura that freeze you to death. He's mysterious, arrogant, loner and a bit rude. He's famous because of being a Crown Prince. A Royal blood Vampire who can rule the world. He has a powerful mage. Every girl dream of having him. His so handsome in every way. That's why any girls in their hometown love him. Want him. But all of them are afraid of him because of his own magical power. Then its start with this :) Hope you'll enjoy. Don't forget to votes, comments and support this story. Thank you
SHERLOCK HOLMES- The Sign Of The Four by ARTHUR CONAN DOYLE by Ikam_Atago
12 parts Complete
link: http://sherlock-holm.es/stories/html/cano.html# DISCLAIMER: I don't own anything in this story. I give the credit to the Author of this story CONAN DOYLE. By entering this site, you declare and affirm under the penalties of perjury that you are not a minor nor in the company of a minor and that accessing this site is not unlawful in your local area. You are entering this site of your own free volition and the owner of it accepts no responsibility for any individual's experience within. User agrees that he or she will hold Wattpad and GodessofLOVE harmless from all claims that may arise or result from any link to or content found on this domain. Furthermore, the user agrees that GodessofLove cannot be held responsible for any damage, claims or any mishaps that may happen to occur from any link leading outside this site. User also agrees that all poetry, literature and content is under full copyright protection by their rightful owner, which falls under the 1976 Copyright Act (title 17, U.S. Code). Any copyrighted content cannot be re-used, re-posted in any way or form. Any author who posts their literature of any type falls automatically under the Copyright Act 17, making his literature copyrighted by him. Therefore, no one is allowed to re-use any form of literature, poetry, short stories in any way. The user understands that violating these rules of copyright can lead to legal prosecution in the court of law under the copyright act 17. By this statment, you enter the site at your own responsibility. no copyright infringement intended.
Hide n Kill by StarnightEclipse
28 parts Complete Mature
Authors' Note This is a story about survival and strategy, about friendship and loyalty, about betrayal and sacrifice. The writing of this story has been a difficult task. We, the authors of this story, had to overcome numerous challenges before we were able to complete it and meet our expectations. This story is fiction and it was created from our vast imagination to provide readers with thrilling thrills and excitement. Scenarios in this story may be similar to those in other stories, but this is not done on purpose. We can't promise to give you all a perfect story because we aren't that experienced in making them and are still growing and learning along the way, but it will be worthwhile as long as we know we've given it our all. Thank you for all of the support and assistance that will be provided to us. We may not name you, but you are all deeply appreciated and remembered in our hearts. Thank you once more, and God bless you! Disclaimer: All names, places, characters, plot twists, and events are purely fictitious creations of the authors. If there is a resemblance, it is purely coincidental and not intended to be adopted. Copyright© All right reserved. No part of this book may be produced, distributed, or transmitted in any form or by any means, including printing, recording or other electronic or mechanical methods, without the prior written permission of the authors, except in the case of brief quotations embodied in critical reviews and certain other noncommercial uses permitted by copyright law. ALL RIGHTS RESERVED
Vampire's Pet by FinnLoveVenn
63 parts Complete Mature
[TAGALOG] Pumasok ka sa Mansion. Mansion na magmimistulang kulungan mo. Ikaw ang laruan at alaga nila, sila ang amo na susundin mo. Makakayanan mo ba maging alaga nila? Lalo na't 'yung apat na magiging amo mo ay mga bampira, bampirang maglalaro sa dugo at buhay mo. AN: THIS STORY IS R18 Uulitin ko R18 po ito, so sa mga hindi open minded d'yan at hindi nakabase ang utak sa PLOT ng STORY. Wag mo na lang basahin at wag na wag mong ire-REPORT dahil hindi naman po ako nagkulang sa paalala. Thank you. | MATURE CONTENT | I don't own any images I used in my book covers. Copyright to the rightful owner. ©All rights reserved 2016 No part of this story may be reproduced or transmitted in any form or means without the author's written permission. Written By: FinnLoveVenn
Stalking My Vampire Crush (Available on Dreame for FREE!) by Vevsorare
46 parts Complete
Highest Rank Achieved: #2 in vampire category! Dasha Livaniez, ang babaeng tinalo pa yata ang mga imbestigador sa pagmamatyag kay Greco Blaize Ferrer-- ang pinaka- misteryoso sa Chariolle University. Kumbaga, si Dasha ang real version ni Dora, gagawin niya ang lahat para lang ma-i-stalk ang super duper ultra mega crush niyang si Greco. Nang dahil umabsent ng isang araw si Grecomylabs niya 'raw' napilitan siyang hanapin ito pati na rin kung nasaan ang bahay nila Greco. She will be able to meet the family of Greco dahil sa stalking power niya. But what if, she'd discover something? Hindi normal, nakakapangilabot at parang 'di kapani-paniwalang pangyayari... Ano kaya ang mangyayari kapag nalaman niya na ang taong ini-istalk niya ay isa palang... BAMPIRA! A HOT VAMPIRE. A MYSTERIOUS ONE. HAS AN EVIL SIDE. COLD HEARTED. AND THE FUTURE KING OF THE VAMPIRES... WILL SHE CONTINUE TO LOVE THIS MAN DESPITE OF HIS REAL IDENTITY? O PIPILIIN NIYA NA LANG NA LUMAYO PARA SA IKABUBUTI NILANG DALAWA? WARNING: IPINANGANAK SA ABNORMALITY SOCIETY ANG INYONG BALIW NA AUTHOR KAYA ASAHAN NIYO NANG PURO KA-ETCHOSAN ANG NAKAPALOOB SA STORY NA ITEY. HINDI PO PERPEKTO ANG GAWA KONG ITO, KAYA KUNG NAGHAHANAP KAYO NG ISANG OBRA MAESTRA, WALA PO ANG HINAHANAP NIYO RITO. KUNG HANAP NIYO NAMAN AY KABALIWAN, KA-ABNORMALAN, KACHAKAHAN, KAGAGAHAN, KAETCHOSAN AT GOOD VIBES, PWES! MARAMI-RAMI 'YAN DITO. XD "STALKING MY VAMPIRE CRUSH" Date Started: June 16, 2017-January 11, 2018 -Vevsorare ( Commander ) Ipagpatawad niyong lahat. Jejedays ko pa ito isinulat. Expect a lot of errors.
The Vampire's Slave ✓ by hikariwanders
15 parts Complete
TAGLISH | PRIMOGENITOR SERIES #1 A Vampire/Fantasy Story [R18+] ⋘ ───────── ∗ ⋅◈⋅ ∗ ───────── ⋙ ❝I owe him my life. He saved me from hell, so I must return the favor, and that is to serve him, until I die.❞ Quineria Valkyrie Astrid Zane Morgan isn't just an average woman because of the fact that she experienced hell in just a very young age. At Hell Mansion-- that's what she calls at the house, she was tortured-- whipped her back several times, punched her face and kicked her fragile body without the headmaster's order. She's the apple of the eye of those who are cruel; she's their favorite subject in torture. But despite of those tortures, they needed to hide all of the girl's bruised, so the 'big boss' won't be turned off. Of course, they will buy them-- the girls, and be their slaves. Until one day, Zane's life change. A maiden-like girl saved her to those two guys who wanted to raped her. It is a blessing in disguise? Or not? Because Zane saw how the beautiful girl merciless kill those two by taking their hearts out of their body, with just her own hand. And then she met the King, and said she will be his slave. She had no choice but to say yes because she's petrified. She witnessed how the Hell Mansion being burned, and how the blood ran through the floor of the dungeon as the lifeless bodies lies on it. But she thought, being slave needs to do hard work, but why do they're so kind of them? It is because she's the one carrying the necklace? Or there's another reason behind of all those kindness? This is how her adventures begin, as The Vampire's Slave. ⋘ ───────── ∗ ⋅◈⋅ ∗ ───────── ⋙ Highest Ranking: #1 in Vampire (11/17/18) Cover by: @Geksxx
The Crystal Academy:The Lost Princess by Princess_Quennie
38 parts Complete
Do you believe that IMMORTAL exist? Vampire,Werewolf,Fairies and others? Well,This story is about Immortality. They are called CRYSTALIAN because they live in the Crystal World where only the Goddess of the Crystal can save Want to know about the story? Then come and explore the Crystal Academy inside in the Crystal World Writer's Note: Hi guys,it's my first story. Hope you'll like it
You may also like
Slide 1 of 10
Claiming The Forbidden (On Going) cover
Her Divine Lover cover
VAMPIRES WORLD cover
ACE OF VAMPIRE cover
SHERLOCK HOLMES- The Sign Of The Four by ARTHUR CONAN DOYLE cover
Hide n Kill cover
Vampire's Pet cover
Stalking My Vampire Crush (Available on Dreame for FREE!) cover
The Vampire's Slave ✓ cover
The Crystal Academy:The Lost Princess cover

Claiming The Forbidden (On Going)

9 parts Ongoing Mature

Harmonica, daughter of the Alpha King but despite being the child of a strong Alpha she was born wolfless. She is a weak wolf. That's why she is kept protected all her life. But what will happen when their sworn enemy invited them into his castle to talk about the treaty of both kingdom? Harmonica was so excited to hear the news but later regret when the Vampire King doesn't want to have peace at all. And now he's starting it with a dirty game that turns out to be the starting point of their own destiny. __________ Can a Forbidden Love conquer all the uncertainties that awaits them? __________ LiolaPhantom Date Started: 07-20-23 Date Ended:

More details