Story cover for Tupac Shakur by liasde
Tupac Shakur
liasde
  • WpView
    MGA BUMASA 8,303
  • WpVote
    Mga Boto 916
  • WpPart
    Mga Parte 75
  • WpHistory
    Oras <5 mins
  • WpView
    MGA BUMASA 8,303
  • WpVote
    Mga Boto 916
  • WpPart
    Mga Parte 75
  • WpHistory
    Oras <5 mins
liasde
Kumpleto, Unang na-publish May 12, 2019
2pac90sdeaddreamefsanegifshiphoplasvegaslegendlegendarymakaveliphotoraprappernripstylethuglifetupacusavintagewallpaperwallpaperswestside
• Photos, gifs and words about Tupac A. Shakur
Public Domain
2pac90sdeaddreamefsanegifshiphoplasvegaslegendlegendarymakaveliphotoraprappernripstylethuglifetupacusavintagewallpaperwallpaperswestside
Table of contents

75 parte

Sign up to add Tupac Shakur to your library and receive updates
o
#41thuglife
Mga Alituntunin ng Nilalaman
Magugustuhan mo rin ang
ᴇᴍᴇʀᴀʟᴅ ᴘᴀʀᴋ. ni TDoThis
34 mga parte Ongoing Mature
"ᴊᴜꜱᴛ ᴛᴇʟʟ ᴍᴇ ᴛʜɪꜱ ᴏɴᴇ ᴛʜɪɴɢ - ᴛʜɪꜱ ᴏɴᴇ ꜰᴜᴄᴋɪɴɢ ᴛʜɪɴɢ...ᴡᴀꜱ ᴀʟʟ ᴛʜɪꜱ ꜱʜɪᴛ ᴡᴏʀᴛʜ ɪᴛ ᴛᴏ ʏᴏᴜ?" ᴛʜᴇ ᴍᴀɴɪᴄ ʟᴏᴏᴋ ɪɴ ʜᴇʀ ᴇʏᴇꜱ ꜱᴛɪʟʟᴇᴅ, ᴀɴᴅ ɪᴛ ᴛᴏᴏᴋ ᴀ ꜰᴇᴡ ꜱᴇᴄᴏɴᴅꜱ ꜰᴏʀ ʜᴇʀ ᴛᴏ ʙʀᴇᴀᴋ ᴏᴜᴛ ɪɴᴛᴏ ᴀ ꜰɪᴛ ᴏꜰ ᴄʜᴜᴄᴋʟᴇꜱ, ᴡɪɴᴄɪɴɢ ꜰʀᴏᴍ ᴛʜᴇ ᴘᴀɪɴ ᴀɴᴅ ᴛʜʀᴏᴡɪɴɢ ʜᴇʀ ʜᴇᴀᴅ ʙᴀᴄᴋ ɪɴᴛᴏ ᴛʜᴇ ᴛɪʟᴇꜱ. "ᴍᴀɴ, ᴊᴜꜱᴛ ꜱʜᴜᴛ ᴛʜᴇ ꜰᴜᴄᴋ ᴜᴘ ᴀɴᴅ ᴘᴜʟʟ ɪᴛ ᴀʟʀᴇᴀᴅʏ..." 2022-23 Project A TDoThis Original New Updates Whenever Vote, comment, and follow if you enjoy Start/End Date: 12/1/22 - [TDOTHIS]
Inspirational Love: You Bring Out the Best in Me (Completed) ni Camillelavender
18 parte Kumpleto Mature
A 2pac & Vanessa Hudgens love story Vanessa Hudgens, a new student at the town of Baltimore enters into the Baltimore School of Arts for acting and dancing. She met a beautiful, handsome guy named Tupac Shakur. He inspires her to think good of herself while she inspires him to do the same. Even though they experienced different up-bringings, they still win eachother's hearts. However, when Vanessa is faced with a traumatic event that could've cost her life, Pac feels guilty. Will his guilt be set free or will it grow them apart?
⋆𝔥𝔬𝔱 𝔰𝔞𝔲𝔠𝔢 |ⁱᵐᵃᵍⁱⁿᵉˢ ni niyascribes
18 parte Kumpleto Mature
𝙃𝙊𝙏 𝙎𝘼𝙐𝘾𝙀- ❝ i got hot sauce in my bag swag i see it, i want it, i stunt, yellow bone it, i dream it, i work hard i grind 'til i own it. ❞
𝐓𝐇𝐔𝐆 𝐋𝐔𝐕. || 𝐭𝐮𝐩𝐚𝐜 𝐬. ni immortalpac
44 mga parte Kumpleto
𝑩𝒂𝒓𝒆 𝒘𝒊𝒕𝒉 𝒎𝒆, 𝑰 𝒌𝒏𝒐𝒘 𝑰 𝒔𝒂𝒚 𝒂𝒍𝒍 𝒕𝒉𝒆 𝒘𝒓𝒐𝒏𝒈 𝒕𝒉𝒊𝒏𝒈𝒔 𝒕𝒉𝒂𝒕 𝒎𝒂𝒌𝒆 𝒚𝒐𝒖 𝒔𝒄𝒓𝒆𝒂𝒎...𝒃𝒖𝒕 𝑰 𝒍𝒐𝒗𝒆 𝒚𝒐𝒖 . ______________________________________________ 🅆🄷🄴🄽 🄸🅃 🄴🄽🄳🅂, 🄸🅃 🄴🄽🄳🅂 . 🄽🄾 🄼🄰🅃🅃🄴🅁 🅃🄷🄴🄷🅄🅁🅃 . "𝗛𝗼𝘄 𝗰𝗼𝘂𝗹𝗱 𝗮 𝘁𝗵𝘂𝗴 𝗹𝗼𝘃𝗲 𝗺𝗲?" 🄻🄴🅃 🄰 🅃🄷🅄🄶 🄻🄾🅅🄴 🄾🄽 🅈🄾🅄 . 𝐈𝐌𝐌𝐎𝐑𝐓𝐀𝐋𝐏𝐀𝐂 © || 2018. (Nominated for the Wattys.)
𝐖𝐓𝐃𝐑 | tupac shakur. ni ovoxots
106 mga parte Kumpleto Mature
⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀ ❛ . . . COME TO DEATH ROW ! ❜ ━━━━━━━━━━━━ in which a young californian native gets signed to the most dangerous record label known to mankind, and loses herself in the midst of it all. ⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀ ⠀⠀ copyright ©️ 2018-2019 ovoxots. All rights reserved. No part of this publication may be reproduced, distributed, or transmitted in any form or by any means, including photocopying, recording, or other electronic or mechanical methods, without the prior written permission of the publisher, except in the case of brief quotations embodied in critical reviews and certain other noncommercial uses permitted by copyright law.
INSANE | Tupac ni TheNalaShakur
25 parte Kumpleto Mature
- After Mileena gets out of prison for "accidentally" running over her husbands mistress. She soon fights to see her 9 year old son who grew up not knowing what really happened to his mom, but only knows she wasn't there most of his life. But that isn't Mileena's only problem. (REMAKE) ( Lisa Lefteye Lopes & Tupac Shakur ) MisunderstoodNani✨
TUPAC IMAGINES. ni storiesbynaya
26 mga parte Kumpleto
cover made by kayla-nicole [ONGOING] "Nobody should be hitting the lotto for thirty six million when we've got people starving in the streets." IMAGINES FOR TUPAC AMARU SHAKUR..
𝐓𝐡𝐚𝐭'𝐬 𝐭𝐡𝐞 𝐰𝐚𝐲 𝐥𝐨𝐯𝐞 𝐠𝐨𝐞𝐬 ni imsoconfused_lol
28 parte Ongoing Mature
𝐋𝐢𝐤𝐞 𝐚 𝐦𝐨𝐭𝐡 𝐭𝐨 𝐚 𝐟𝐥𝐚𝐦𝐞 , 𝐛𝐮𝐫𝐧𝐞𝐝 𝐛𝐲 𝐭𝐡𝐞 𝐟𝐢𝐫𝐞 𝐌𝐲 𝐥𝐨𝐯𝐞 𝐢𝐬 𝐛𝐥𝐢𝐧𝐝 𝐜𝐚𝐧'𝐭 𝐲𝐨𝐮 𝐬𝐞𝐞 𝐦𝐲 𝐝𝐞𝐬𝐢𝐫𝐞? W A R N I N G This story contains various mature topics such as sexual content, violence, drug usage, vulgar language, etc.
Family Ties (BOOK V) ni daesrevolution
71 parte Kumpleto Mature
secrets, lies, and FAMILY TIES..
90's Hearthrobs: Male Edition ni EarlsFavSweatshirt
29 mga parte Kumpleto Mature
Some Imagines about the beautiful african american men we wish we were around to date in the 90's. All these Imagines will be set in the 90's. Complete. All of these Imagines are of my own imagination. Copyright © 2019 by Kashahnah Brooks. All rights reserved.
Magugustuhan mo rin ang
Slide 1 of 10
ᴇᴍᴇʀᴀʟᴅ ᴘᴀʀᴋ. cover
Inspirational Love: You Bring Out the Best in Me (Completed) cover
⋆𝔥𝔬𝔱 𝔰𝔞𝔲𝔠𝔢 |ⁱᵐᵃᵍⁱⁿᵉˢ cover
𝐓𝐇𝐔𝐆 𝐋𝐔𝐕. || 𝐭𝐮𝐩𝐚𝐜 𝐬. cover
𝐖𝐓𝐃𝐑 | tupac shakur. cover
INSANE | Tupac cover
TUPAC IMAGINES. cover
𝐓𝐡𝐚𝐭'𝐬 𝐭𝐡𝐞 𝐰𝐚𝐲 𝐥𝐨𝐯𝐞 𝐠𝐨𝐞𝐬 cover
Family Ties (BOOK V) cover
90's Hearthrobs: Male Edition cover

ᴇᴍᴇʀᴀʟᴅ ᴘᴀʀᴋ.

34 mga parte Ongoing Mature

"ᴊᴜꜱᴛ ᴛᴇʟʟ ᴍᴇ ᴛʜɪꜱ ᴏɴᴇ ᴛʜɪɴɢ - ᴛʜɪꜱ ᴏɴᴇ ꜰᴜᴄᴋɪɴɢ ᴛʜɪɴɢ...ᴡᴀꜱ ᴀʟʟ ᴛʜɪꜱ ꜱʜɪᴛ ᴡᴏʀᴛʜ ɪᴛ ᴛᴏ ʏᴏᴜ?" ᴛʜᴇ ᴍᴀɴɪᴄ ʟᴏᴏᴋ ɪɴ ʜᴇʀ ᴇʏᴇꜱ ꜱᴛɪʟʟᴇᴅ, ᴀɴᴅ ɪᴛ ᴛᴏᴏᴋ ᴀ ꜰᴇᴡ ꜱᴇᴄᴏɴᴅꜱ ꜰᴏʀ ʜᴇʀ ᴛᴏ ʙʀᴇᴀᴋ ᴏᴜᴛ ɪɴᴛᴏ ᴀ ꜰɪᴛ ᴏꜰ ᴄʜᴜᴄᴋʟᴇꜱ, ᴡɪɴᴄɪɴɢ ꜰʀᴏᴍ ᴛʜᴇ ᴘᴀɪɴ ᴀɴᴅ ᴛʜʀᴏᴡɪɴɢ ʜᴇʀ ʜᴇᴀᴅ ʙᴀᴄᴋ ɪɴᴛᴏ ᴛʜᴇ ᴛɪʟᴇꜱ. "ᴍᴀɴ, ᴊᴜꜱᴛ ꜱʜᴜᴛ ᴛʜᴇ ꜰᴜᴄᴋ ᴜᴘ ᴀɴᴅ ᴘᴜʟʟ ɪᴛ ᴀʟʀᴇᴀᴅʏ..." 2022-23 Project A TDoThis Original New Updates Whenever Vote, comment, and follow if you enjoy Start/End Date: 12/1/22 - [TDOTHIS]

Karagdagang detalye