Gone|| A Jachary Story
noiceeedudeeee
  • Membaca 1,786
  • Suara 33
  • Bagian 17
  • Durasi 23m
  • Membaca 1,786
  • Suara 33
  • Bagian 17
  • Durasi 23m
noiceeedudeeee
Lengkap, Awal publikasi Mei 14, 2019
childrenofwdwgayjacharyjackaverujackaveryjackxzachromancewdwwdwfamilywdwkidswhyamidoingthiswhydontwezachherron
.
Domain Publik
childrenofwdwgayjacharyjackaverujackaveryjackxzachromancewdwwdwfamilywdwkidswhyamidoingthiswhydontwezachherron
Daftar isi

17 bab

Daftar untuk menambahkan Gone|| A Jachary Story ke perpustakaan Anda dan menerima pembaruan
atau
#857jachary
Panduan Muatan
anda mungkin juga menyukai
𝓢𝓮𝓮 𝓜𝓮 oleh jackssfox
104 Bagian Lengkap
What if Aaron Warner's sunshine daughter fell for Kenji Kishimoto's grumpy son? - This fanfic takes place almost 20 years after Believe me. Aaron and Juliette had a Daughter named Emmaline Leila Warner. Kenji and Nazeera had a son named Kai Kishimoto. Started: 12, Nov, 2023 Highest Ranking: #1 booktok #1 shatterme #1 fantasyfiction #1 bookclub #2 romancefanfiction #2 warnette #2 kenjikishimoto
Stolen Passion oleh inlovewithmilfsx
52 Bagian Sedang dalam proses
Elizabeth Olsen, one of the new professors at the highschool. She's a beautiful and intelligent woman in her mid thirties. She's a strict and cold woman in class. Isabel Reyes, one of the popular girls in school. Confident and with a curious mind, outgoing and never one to back away from a challenge. Teacher x student 18 years difference WLW
HEAT [sabrina x billie fanfiction] oleh sheeshwhatshappening
74 Bagian Sedang dalam proses
on the surface, sabrina carpenter is everything she's supposed to be: polished, perfect, straight. but when a single look from billie eilish makes something shift, the cracks in her carefully crafted image start to show. billie, who has always known exactly who she is, recognizes that look instantly. she knows what it means. and she's curious. the air between them is warm at first - just a flicker, a glance, a harmless pull. but heat rises. and once it starts, it's impossible to ignore.
In DxD with Sign-In System! oleh Dragon155913
104 Bagian Sedang dalam proses
Transmigrated into DxD World-Kuoh Town, Hibari Kyoya. an average student, spent 18 agonizing years in the world fully aware of the dangers, knowing he is utterly powerless in a world of gods and monsters, Until... [Ding! Sign-In System loading... 20%... 50%... 80%... 100%.] Destiny, it seems.. has a cruel sense of humor. A [Sign-In System], long overdue, finally bursts to life within him, offering a chance at survival, a chance at power... [Ding! Congratulations! You have received the Rainbow-Grade Gift Bag!] ... He then started completing System's tasks, accumulating even greater rewards. [Ding! Task completed. Reward: Perfect Rumble-Rumble Fruit (Weakness to water Removed).] [Ding! Task completed. Congratulations to the host for obtaining the Flying Thunder God Technique!]
The Brink of Minds | Tim Bradford oleh writer_daydreamerr
58 Bagian Sedang dalam proses
❝The way you're looking at me right now makes me wonder where you want me.❞ stolen glances, hushed whispers, teasing breaths, lingering touches. 𝘖𝘳 𝘪𝘯 𝘸𝘩𝘪𝘤𝘩 𝙝𝙖𝙧𝙙𝙘𝙤𝙧𝙚 𝙢𝙚𝙚𝙩𝙨 𝙝𝙖𝙧𝙙𝙘𝙤𝙧𝙚, 𝘢𝘯𝘥 𝘮𝘢𝘨𝘯𝘦𝘵𝘴 𝘢𝘳𝘦 𝘮𝘦𝘢𝘯𝘵 𝘵𝘰 𝘢𝘵𝘵𝘳𝘢𝘤𝘵 𝘦𝘢𝘤𝘩 𝘰𝘵𝘩𝘦𝘳. ─ tim bradford x fem!oc ─ the rookie; s1 ~ s6 ─ SLOW-burn, flirting, ANGST, some spice ─ frequent updates!! ⊱ ──────── ➤ ──────── ⊰
Falling For Mikhaela Janna Jeminea Lim oleh duskravennn024
78 Bagian Lengkap
Mikhaela Janna Lim, daughter of a renowned business tycoon, craves a normal life away from the spotlight. She even persuades her famous friends to pretend they don't know her, all for the sake of solitude. But when her path crosses with Maraiah Queen Arceta-a social butterfly, soft talker, and academic achiever adored by many-everything changes. Will Mikhaela cling to her quiet sanctuary as an anonymous introvert, or transform herself to win Maraiah's heart?
Witch Hunt: Reincarnated as Petunia Evans oleh LittleEmberLou
49 Bagian Sedang dalam proses
Petunia falls and gets some sense knocked into her. Now armed with the memories of her last life she tackles this one with new gusto. Just one problem, she's read so many fanfictions that she can't quite remember what's cannon and what isn't. Sure she knows the basics but that's about it. All well, she'll figure it out. First things first, time to make some money by selling stories! What do you mean she can't, she'd only eleven? Na, she was in university last life. Nothing like sending your work in under a pen name... or three... Surely no body will find out she's the author of not one, not two, but three successful romance series. Surely... *Smirks* We now have a discord!! https://discord.gg/hJ4NjRZrXv Loosely inspired by the anime 'My Next Life As a Villainess' Petunia x Severus Lily x Remus
Francesca. oleh bridalshowers
11 Bagian Sedang dalam proses
Heaven is not fit to house a love Like you and I. Tommy Shelby / oc. Peaky Blinders. 2025 © bridalshowers cover by @freaklowden
You Promised | Mark Sloan ✓ oleh writer_daydreamerr
98 Bagian Lengkap
❝I'm not going anywhere, because you're the one.❞ She was the fall he had always desired. He was the warmth she never knew she needed. They were love at first sight that neither realised... Warm and fuzzy. Friendships and romance. Traumas and memories. Neck kisses and ticking clocks. Heartbreaks and a great love story. ​ ─ mark sloan x fem!oc ​ ─ grey's anatomy; s2 ~ s9 ​ ─ fluffs & ANGST (beware you may cry,,) ​ ─ posted on AO3 under same username ⊱ ──────── ❦ ──────── ⊰
Wrong Number~ Charles Leclerc oleh Chris_P_Bacon12
72 Bagian Lengkap
When an archeology student accidently gets added in a groupchat full of f1 drivers. Or When Charles Leclerc falls for the stranger in the groupchat social media & irl (Updates every day or every other day)
anda mungkin juga menyukai
Slide 1 of 10
𝓢𝓮𝓮 𝓜𝓮 cover
Stolen Passion cover
HEAT [sabrina x billie fanfiction] cover
In DxD with Sign-In System! cover
The Brink of Minds | Tim Bradford cover
Falling For Mikhaela Janna Jeminea Lim cover
Witch Hunt: Reincarnated as Petunia Evans cover
Francesca. cover
You Promised | Mark Sloan ✓ cover
Wrong Number~ Charles Leclerc cover

𝓢𝓮𝓮 𝓜𝓮

104 Bagian Lengkap

What if Aaron Warner's sunshine daughter fell for Kenji Kishimoto's grumpy son? - This fanfic takes place almost 20 years after Believe me. Aaron and Juliette had a Daughter named Emmaline Leila Warner. Kenji and Nazeera had a son named Kai Kishimoto. Started: 12, Nov, 2023 Highest Ranking: #1 booktok #1 shatterme #1 fantasyfiction #1 bookclub #2 romancefanfiction #2 warnette #2 kenjikishimoto

Detail lengkap