Avadel Ink - Graphic Design Shop III [OPEN]
avadel
  • Reads 43,989
  • Votes 2,207
  • Parts 162
  • Time 32m
  • Reads 43,989
  • Votes 2,207
  • Parts 162
  • Time 32m
avadel
Ongoing, First published Aug 28, 2019
artbannerschapter-breakcommercialcommissioncovercoverrequestcoverscovershopcustomerservicedesignfriendlygraphic-designgraphicspolishedpremaderandomshopsleekstickersstriking
[✓] Commercial Covers 
[✓] Premades
[✓] Non-commercial commissions

*~*~*~*~*
Sleek. Polished. Striking. In this graphics shop, we strive to provide you with an image that embodies all of these qualities, along with a fantastic customer experience. Costs are flexible and forms are minimal, so scroll through. See what we can do for you. Then kick back and enjoy your customized, hassle-free graphic. (;

NOW OFFERING COMMERCIAL COVERS! PM for details. Commercial covers are always serviced first. 
*~*~*~*~*

Copyright Questions: All of our graphics are made using common domain images, so you don't have to worry about any copyright issues. However, every piece is copyrighted by us, so please do not download other people's commissions. We retain all rights to the art. (=

Thank you for considering us, and have a marvelous day!

____________________________________

"Their covers are masterpieces. Never once did they fail to meet my expectations" - @bluexgomez
"I wouldn't trade y'all for any other cover shop." - @nickilovestoread1
"I need to write more so I can get some more of your wonderful covers!" - @OctaviaLocke
"Absolutely incredible" - @TasSSingh
All Rights Reserved
artbannerschapter-breakcommercialcommissioncovercoverrequestcoverscovershopcustomerservicedesignfriendlygraphic-designgraphicspolishedpremaderandomshopsleekstickersstriking
Table of contents

162 parts

Sign up to add Avadel Ink - Graphic Design Shop III [OPEN] to your library and receive updates
or
#292friendly
Content Guidelines
You may also like
Wendizzy's Writer Room by Wendizzy
2 parts Ongoing
In this book, you'll get a behind the scenes look at how your favorite characters were born, my creative process, and the dirty details never before revealed. Tex's Camp Q&A: Come sit by the fire and ask me whatever you'd like. We can roast marshmallows, tell scary stories, and hang out in the comments like a big, happy family. Gator's Backstage Pass: A place full of secrets. Learn the-sometimes embarrassing-details on how my wildest scenes came to life, facts about the characters, the process, and myself.
You may also like
Slide 1 of 1
Wendizzy's Writer Room cover

Wendizzy's Writer Room

2 parts Ongoing

In this book, you'll get a behind the scenes look at how your favorite characters were born, my creative process, and the dirty details never before revealed. Tex's Camp Q&A: Come sit by the fire and ask me whatever you'd like. We can roast marshmallows, tell scary stories, and hang out in the comments like a big, happy family. Gator's Backstage Pass: A place full of secrets. Learn the-sometimes embarrassing-details on how my wildest scenes came to life, facts about the characters, the process, and myself.

More details