𝗧𝗛𝗘 𝗢𝗧𝗛𝗘𝗥 𝗪𝗢𝗠𝗔𝗡. park joong gil.
KpoperArea
  • Reads 2,185
  • Votes 99
  • Parts 4
  • Time 15m
  • Reads 2,185
  • Votes 99
  • Parts 4
  • Time 15m
KpoperArea
Ongoing, First published Sep 01, 2019
arrangedmarriagefantasygrimreaperkdramakooryeonkpoperarealeesoohyuklimryungguonesidedparkjonggilparkjoonggilryeonsoohyukthrillertomorrowtomorrowkdramaunrequited
❝ don't you understand, 𝘆𝗼𝘂'𝗿𝗲 the other woman❞

 ❝ NO! 𝘆𝗼𝘂'𝗿𝗲 married to me. 𝘀𝗵𝗲'𝘀 the other woman ❞
  
  
    ╰ TOMORROW : [ the other woman! ]   
          ❝ The other woman will 
              always cry herself to sleep. 
              The other woman will
              never have his love to keep.
              And as the years go by, 
              the other woman will
              spend her life alone.
              Alone. ❞
  
    
          𝐈𝐍 𝐖𝐇𝐈𝐂𝐇 sihyeon is a hopeless romantic, yearning for the love she wants to have in every reincarnation but none of them fulfilled her longing heart except her husband-who has another wife.
  
    
  park joonggil  x 𝗳𝗲𝗺!𝗼𝗰.
  
  𝘀𝘁𝗮𝗿𝘁𝗲𝗱: 07 / 12 / 2024.
  𝗰𝗼𝗺𝗽𝗹𝗲𝘁𝗲𝗱:  tba.
All Rights Reserved
arrangedmarriagefantasygrimreaperkdramakooryeonkpoperarealeesoohyuklimryungguonesidedparkjonggilparkjoonggilryeonsoohyukthrillertomorrowtomorrowkdramaunrequited
Table of contents

4 parts

Sign up to add 𝗧𝗛𝗘 𝗢𝗧𝗛𝗘𝗥 𝗪𝗢𝗠𝗔𝗡. park joong gil. to your library and receive updates
or
#2tomorrow
Content Guidelines
You may also like
Fate Of The Tally [Kim Ga-On - "The King's Affection" FF] by Cpdimealaxy
55 parts Ongoing
Lee Haeun is Lee Hwi's and Dam-i's younger sister. What happens when the truth of different events and mysteries come to light one by one? Will she discover the whole truth? Or will she be deceived once again. Will she be able to find true love in all of the mess? Read to find out... (This is a Kim Ga-On *AKA, the fine bodyguard in "The King's Affection"* FF.) <A/N: This FF will follow the show's story-line, but not entirely. Some scenes will be changed, and some will not. ***If you have not watched the show, and plan on watching it, know that there are spoilers in this book.***> Published: May 28th, 2022 Ended: *Still Ongoing*
✓ Interstellar kitchen live broadcast daily by ruwen05026
110 parts Complete
Author: black cat white white category: BL doujin Foodie Si Nuo traveled to the era of interstellar orcs, and became a female teenager whose marriage was divorced due to a disability in the spiritual domain, and was sent to the "countryside" agricultural star! Fortunately, he has the golden finger necessary for time travel - the Foodie Becomes God System. Consuming spiritual food can restore the spiritual domain, and fan favorite points can be exchanged for new recipes and gain buffs. At the beginning of the live broadcast, Si Nuo suffered rotten eggs from the audience, thinking that he was simply wasting spiritual materials! However, looking at a series of delicious spiritual foods that are more effective than potions, and full of color, fragrance, but can't eat... The female orc elixir drooled and gave a gift: Ahhh, please open a shop! Ask for apprentices! The male orc warriors sent flowers with red eyes: Aww, please feed! Ask for contacts! The gourmet anchor who is popular among the stars because of his looks but his cooking skills [small theater] "When we first met" Xiao Shou: I picked up a little furry black cat, so soft and cute! Take it home as a pet! Xiaogong: I picked up a white and tender little female, so soft and cute! Abducted home to be a daughter-in-law! "After a while" Xiao Shou: The little black cat is so edible, I really want to throw it away! Xiao Gong: The little female is so delicious, I really want to eat it! JUST IN CASE, THIS STORY IS: ✓ PURELY MTL(means this is not edited, so expect the incorrect pronouns, indents, and grammatical errors. :D) ✓ FOR OFFLINE PURPOSE ONLY ( just uploaded here for my smooth offline reading) ✓ Do Not Report, Do Not Vote, Just Read ✓ DISCLAIMER: I do not own the cover nor the story, this is all for offline reading.
Palagi (BOOK 1) by wisdom4ever
37 parts Complete
(MIKHAIAH) What if you meet your palagi? Palaging nandiyan, palaging kasama mo, palagi kang ililigtas, palaging papagaanin loob mo. Atasha Queen Arceta. The campus crush, Abm student, flight attendant, bust chose to pursue photography. Mira's one and only, Mira's first love. The girl who's ready to sacrifice everything, for her love. She's not scared to sacrifice. Mira Janna Jimenea Lim. The volleyball player, the campus crush, stem student, engineer, Atasha's first love. Her life is full of shits. Having stalker. But someone will come to her life, to protect her. Showing no mercy. Palagi... Started-May 20, 2024 Ended-June 12, 2024
In your time ━━ Lovely runner by Softiee_Mochi
13 parts Ongoing
Im Hye-Jin, a 34-year-old woman who has found success in the fashion industry. Her life changed when Ryu Sun-Jae bravely rescued her and her sister, Sol, from a severe car accident that left Sol with a disability. The situation takes a tragic turn when Sun-Jae tragically ends his own life in his hotel room. Subsequently, transported back to 2008, Hye-jin has been given the responsibility of safeguarding Sun-jae from succumbing to depression and securing his well-being in order for her sister to carry on with her life. Unbeknownst to her, she soon becomes caught in a complicated romantic situation involving three individuals, making it challenging for her to disentangle herself from it. The question remains: can she alter the course of this tragic fate? Beautiful cover made by: @magickingdomedi & @PSYHI- Ryu Sun-Jae x ¡Fem!Oc Started: 5/1/24 Published: 5/30/24 Finished:
•𝕯 𝖊 𝖜 𝖉 𝖗 𝖔 𝖕• 𝓐𝓵𝓬𝓱𝓮𝓶𝔂 𝓞𝓯 𝓢𝓸𝓾𝓵𝓼 by I_got_a_jam_store_
10 parts Ongoing
≿━━━━༺❀༻━━━━≾ "ᵀᴴᴱ ᶠᴸᴼᵂᴱᴿ ᵀᴴᴬᵀ ᴮᴸᴼˢˢᴼᴹˢ ᴵᴺ ᴬᴰⱽᴱᴿˢᴵᵀʸ ᴵˢ ᵀᴴᴱ ᴹᴼˢᵀ ᴿᴬᴿᴱ ᴬᴺᴰ ᴮᴱᴬᵁᵀᴵᶠᵁᴸ ᴼᶠ ᴬᴸᴸ" "ʸᵒᵘ ᵃʳᵉ ᵗʰᵉ ˡᵒᵛᵉ ᵗʰᵃᵗ ᶜᵃᵐᵉ ʷⁱᵗʰᵒᵘᵗ ʷᵃʳⁿⁱⁿᵍ; ʸᵒᵘ ʰᵃᵈ ᵐʸ ʰᵉᵃʳᵗ ᵇᵉᶠᵒʳᵉ ᴵ ᶜᵒᵘˡᵈ ˢᵃʸ ⁿᵒ." ≿━━━━༺❀༻━━━━≾ '°°'°°'°'°'°°'°°'°'°'°°''°'°'°°'°'°'°'°'°'°'°'°'°'°'°°''°'°'°'°'°°'° Cover by the talented @Bloody_RedWine _______________________________________________ ------------------------ ALL CREDITS GOES TO THE WRITERS OF THIS SHOW. I DO NOT OWN ANY CHARACTERS BESIDES THE ONE I CREATED. PLEASE DO COMMENT AND ENJOY THE STORY.
Watch Out!-Train to Busan- by taichiiii06
9 parts Complete
What if Jin-Hee took the baseball's team, and her's, number one fan, her little sister Joo Hee. What happens then? Will it all change because of her? This book will contain my other OCs' short story, since they will be apart of the 2 other series. Highest Ranks: #2 in traintobusan #1 in traintobusan
Endless Road || Yuzuru Hanyu by byJianLucas
30 parts Complete
"Dreams we won't bear to lose. You can't just move on from something you desire with your heart and soul. There's a word that can describe the feeling of leaving something behind, but, it doesn't exist in my vocabulary. I always do what I need to get what I love and want to keep for the rest of my life." For my friend Andrea who loves this man so much. Special Edition. Started: December 02, 2019. Ended: February 10, 2021. |Yuzuru Hanyu fanfiction| ONGOING GROUP 3 - COLLECTION 2019-2020
Because (BNHA x Male OC) by silverowlbells
32 parts Ongoing
Iwamoto has been in love with his best friend Midoriya Izuku for years now. He always told Izuku he'd go to the same high school as him, and then the same University, but Midoriya always maintained that he'd become a hero and go to U.A. So now that Izuku's got a quirk and is seriously training for U.A, Chiharu has to start training with his own quirk. He's got his own pro hero mentor too. Its his quirk isn't really suited to becoming a hero. (I don't own bnha, it'd be cool if I did though. Hope I can keep you all entertained!)
𝐘𝐎𝐔𝐓𝐇. ⎯ KANG HA ✓ by Cherryblossomkoo
7 parts Ongoing
𝐘𝐎𝐔𝐓𝐇. ⎯ KANG HA ✓ HIERARCHY ™ ❝ 𝙬𝙝𝙮 𝙖𝙧𝙚 𝙮𝙤𝙪 𝙧𝙚𝙖𝙡𝙡𝙮 𝙝𝙚𝙧𝙚 ? ❞ ׂ╰┈➤𝙄𝙉 𝙒𝙃𝙄𝘾𝙃 a mysterious transfer student enters the school for the prestigious and elite and ends up shaking up the hierarchy set in place. 𝘽𝘼𝙎𝙄𝘾𝘼𝙇𝙇𝙔 - ,, rich kids with too many secrets along with complicated romances and a transfer who hides behind a smile. ⌗ 𝐑.𝐈.𝐏 𝟐 𝐌𝐘 𝐘𝐎𝐔𝐓𝐇 . theneighborhood 𝐉𝐔𝐍𝐄 '24 - ??
𝙎𝙪𝙥𝙚𝙧𝙣𝙤𝙫𝙖 [the atypical family | bok gwi-ju × oc] by KJY0095
9 parts Ongoing
Young budding psychiatrist, Han Yeoreum, gets involved with the Bok family as she got closer to Bok Ina. The whole family wonders how that happened, and grew some interest in her. But for Bok Gwiju, she's a little bit more special... Bok Gwiju × OC
You may also like
Slide 1 of 10
Fate Of The Tally [Kim Ga-On - "The King's Affection" FF] cover
✓ Interstellar kitchen live broadcast daily cover
Palagi (BOOK 1) cover
In your time ━━ Lovely runner cover
•𝕯 𝖊 𝖜 𝖉 𝖗 𝖔 𝖕• 𝓐𝓵𝓬𝓱𝓮𝓶𝔂 𝓞𝓯 𝓢𝓸𝓾𝓵𝓼 cover
Watch Out!-Train to Busan- cover
Endless Road || Yuzuru Hanyu cover
Because (BNHA x Male OC) cover
𝐘𝐎𝐔𝐓𝐇. ⎯ KANG HA ✓ cover
𝙎𝙪𝙥𝙚𝙧𝙣𝙤𝙫𝙖 [the atypical family | bok gwi-ju × oc] cover

Fate Of The Tally [Kim Ga-On - "The King's Affection" FF]

55 parts Ongoing

Lee Haeun is Lee Hwi's and Dam-i's younger sister. What happens when the truth of different events and mysteries come to light one by one? Will she discover the whole truth? Or will she be deceived once again. Will she be able to find true love in all of the mess? Read to find out... (This is a Kim Ga-On *AKA, the fine bodyguard in "The King's Affection"* FF.) <A/N: This FF will follow the show's story-line, but not entirely. Some scenes will be changed, and some will not. ***If you have not watched the show, and plan on watching it, know that there are spoilers in this book.***> Published: May 28th, 2022 Ended: *Still Ongoing*

More details