Story cover for fem reader x jack/antisepticeye x Mark/darkiplier x oc/evil persona oc by nappa623
fem reader x jack/antisepticeye x Mark/darkiplier x oc/evil persona oc
nappa623
  • WpView
    Reads 30
  • WpVote
    Votes 0
  • WpPart
    Parts 3
  • WpHistory
    Time 8m
  • WpView
    Reads 30
  • WpVote
    Votes 0
  • WpPart
    Parts 3
  • WpHistory
    Time 8m
nappa623
Ongoing, First published Sep 10, 2019
antisepticeyedarkiplierfemreaderjacksepticeyemarkiplierốc
What if jack and Mark never became YouTubers but we're college students.so like always the premise of the story will be in the bio (first page)
All Rights Reserved
antisepticeyedarkiplierfemreaderjacksepticeyemarkiplierốc
Table of contents

3 parts

Sign up to add fem reader x jack/antisepticeye x Mark/darkiplier x oc/evil persona oc to your library and receive updates
or
#478antisepticeye
Content Guidelines
You may also like
Ipliers and Septiceye One-Shots by OfficialCatFiction
12 parts Complete Mature
FINISHED! This is quite an old book, I keep it on here because it gives me confidence and I like looking back on my old work. Please don't expect any more books like this as I want to write in a style that is my own. Hope you all understand and check out my future works, CF xxx
I can't live without you (Demons Can't Love Sequel) by xitslittyyx
11 parts Complete
**NO SMUT!!** Anti has been depressed lately. He hasn't eaten in months.. but one night he finally takes over Jacks body again, and it turns into a wild ride. Septiplier/antiplier/antiseptiplier fanfic.
Popular (Jacksepticeye x Reader) by NotSoSecretlyInLove
34 parts Complete Mature
First chapter doesn't fully match with story, but I'm too lazy to fix it. BUT ENJOY!! (Previously: "PewDiePie's Little Sis")
kidnapped by markiplier and jacksepticeye by Zeldagamerperson
45 parts Complete
Hello this story is going under editing so the chapter will be different but nothing major to the story Book 2 will be out soon
MANIPULATED Book A (Sequel to Tempted) by CorruptedN1ghtmare
46 parts Complete
IF YOU HAVE NOT READ "AREN'T YOU TEMPTED", PLEASE DO SO. AS THIS WILL MAKE ABSOLUTELY NO SENSE TO YOU WHATSOEVER. You decided to: let him stay. Welcome back reader. So... You decided to let Anti stay, huh? Was that really the smartest choice? Dont worry, if you want to change your mind after reading the description, you can. But as soon as you start to read the first chapter of any of the two books, your fate has been sealed. Like I said before: choose WISELY. But if you are fully convinced that this is the only way to go, then by all means, go forth on your journey. Anti is now a part of you. You released him from Jack's prison of a body, and now he is a piece of you. He can now roam free, without any barriers holding him back. But if a demon has possession over your soul and speaking into your mind, wouldn't that change some things? Your decisions? Your thoughts? You bet. And you've head Anti mention every once and a while something about 'another evil' causing pain and suffering to other people. It has caused you to wonder what that may be. And now Anti thinks that this exact thing is making it's comeback. And Anti is seen as a threat and is now being targeted. And that means you are too. SAME WARNINGS GO FOR THIS BOOK ⚠️WARNING ⚠️ Contains strong language, blood, violence, ❌possible trigger warnings❌ And not-so-smut (yes its a thing because I invented it. It means there some smut but like nothing actually HAPPENING. At least not in writing...)
From Bad to Good(Anti Septiceye and Darkiplier X Reader) by Emiplier_5
29 parts Complete
Another fanfiction! Enjoy! You are in your college classroom packing up when an alarm goes off. An announcement comes on telling everyone to calm down and not panic. Then, the power goes off. You hear footsteps approaching the door. The intruders smash their way through. They scan the classroom. Then, they point to you. You knew them straight away. They were Anitsepticeye and Darkiplier. They were from youtube. That's why you know them. They were the opposites of Markiplier and Jacksepticeye, your idols. They move their finger, and everyone blacks out except for you. They kidnapped you, and were brought to an unknown location. They made a proposition to you. You help them go back where they came from and they would leave your life for good. They soon bring you into their life, and everything changes for you. Will you help them go back home? Will evil stop you? Will you actually become friends with them or maybe more?
I'm Here to Help You (Darkiplier x Reader) by the_bluepencil
35 parts Complete
{COMPLETED} This is my first story, so only constructive criticism, please. Also, there's no smut. Sorry not sorry. I ain't writing that shit. Also also, there's probably gonna be some gore, but that's to be expected. I'll keep the character pretty gender neutral, but I'm personally a demigirl so forgive me if the character seems a bit feminine at times. ◊◊◊ You're a pretty average person. Your parents are divorced, but that's not really unique. You're kinda pessimistic, some venture to call you "depressed" or "emo", but everybody goes through that phase. ◊◊◊ "Can't you just leave me alone for one night?" I snap. His laughs only fuel my rage. "I'm here to help you - Can't you see that?" he soothes. I just glare at him. "Yeah, making me kill a guy and driving me insane is real 'helpful'. Thanks." The demon shakes his head. "You don't understand, yet. I'm freeing you from the prison that is your conscience." "No, thanks. I like not being a sociopath." "Do you?"
Markiplier Imagines by AbiEvans
64 parts Complete
Markiplier x Reader imagines and maybe one or two chapters of Septiplier just because I can't resist. Some fluffy ones, some funny ones. Some weird ones and some cute ones. Requests are open. Hope you enjoy it.
Who Are You Really? (Dark X Reader X Anti) [Discontinued] by Captain_Mischief
15 parts Complete
You just finished school and decided to move to L.A. You moved right into your new apartment. After a few months living in L.A. You got used to your new surroundings. You find out that your favorite YouTuber is staying in L.A for a while. As you watch your favorite YouTubers videos mark and Sean look weaker. It didn't seem right. Then you get a mystery video that somehow felt realistic. Find out what happens to you and the two famous YouTubers. Jacksepticeye and Markiplier.
Savior by IceQueen713
18 parts Complete Mature
: Book 1 : :TRIGGER WARNING:PLEASE READ: trigger warning I will not give any further warning it ruins the atmosphere this story will have topics for a mature audience such as possible lemon rape death slight Gore cursing and is recommended for 18+ or you may read at your own risk. Disclaimer: I Don't own Markiplier/Darkiplier Jacksepticeye/Antisepticeye and NONE of the Artwork or Photo's are Mine they are off of a Public Domain such as Twitter/Facebook. Thank You ♡
You may also like
Slide 1 of 10
Ipliers and Septiceye One-Shots cover
I can't live without you (Demons Can't Love Sequel) cover
Popular (Jacksepticeye x Reader) cover
kidnapped by markiplier and jacksepticeye cover
MANIPULATED Book A (Sequel to Tempted) cover
From Bad to Good(Anti Septiceye and Darkiplier X Reader) cover
I'm Here to Help You (Darkiplier x Reader) cover
Markiplier Imagines cover
Who Are You Really? (Dark X Reader X Anti) [Discontinued] cover
Savior cover

Ipliers and Septiceye One-Shots

12 parts Complete Mature

FINISHED! This is quite an old book, I keep it on here because it gives me confidence and I like looking back on my old work. Please don't expect any more books like this as I want to write in a style that is my own. Hope you all understand and check out my future works, CF xxx

More details