Story cover for Ember d'Amant by RebaGiroux
Ember d'Amant
RebaGiroux
  • WpView
    Reads 92
  • WpVote
    Votes 23
  • WpPart
    Parts 22
  • WpHistory
    Time 2h 28m
  • WpView
    Reads 92
  • WpVote
    Votes 23
  • WpPart
    Parts 22
  • WpHistory
    Time 2h 28m
RebaGiroux
Ongoing, First published Sep 28, 2019
Mature
adventuredragonsdwarveselvesfantasymagicmedievalvampire
The realm of Toikenia has not known freedom for nigh on two decades. Aurorlavich, Mistress of Evil, has seen to that. But when young Megie Devalos finds her life turned upside down in a mad quest for vengeance, a beacon of hope gleams on the horizon. Can Megie find her place in the world before it's too late? Will she find the answers she seeks? And why is Aurorlavich so interested in her?
All Rights Reserved
adventuredragonsdwarveselvesfantasymagicmedievalvampire
Table of contents

22 parts

Sign up to add Ember d'Amant to your library and receive updates
or
Content Guidelines
You may also like
The Chronicles of the Shadow-Realm - Part 1: Into the darkness by LeNaAdine
5 parts Ongoing
Martha, a shy 16-year-old girl living in Germany, is no fan of unnecessary risks - let alone adventures. But a school trip to the Berchtesgaden Alps quickly spirals into a nightmare... Will Martha manage to overcome her greatest fears and face epic challenges? Let yourself be drawn into the world of Alalea! Bloodthirsty monsters and nightmarish adventures await you in the Shadow Realm... This novel is just the beginning of an adventurous journey full of surprises...
Death of the Ghost by pasiphrosyne
5 parts Ongoing
In a realm where love blooms like a rose in a graveyard, their souls were cursed to meet and break. A goddess reborn. A demon god undone. He has watched her die in many lifetimes, each ending more brutal than the last, all because of a curse he cannot break - and a love he was cursed to never forget. But when the world fractures and destiny shifts, the woman he saves is not the goddess he remembers. None of her predecessors were, yet she too was sentenced to death by capricious fate. In a land of gods and monsters, where memory twists and fate is a deadly weapon, death may be the only escape.
The Bane of the Empire by AnnyVirdi
41 parts Complete
The world is ruled by a tyrant King. The Old King was killed and with him the magic that coursed through the world was sealed away. Dawn Rentradie, a human girl, is sent to Eastmaw to collect a tome that triggers a sequence of events that places her in the path of a Fae warrior named Hunter. Follow Dawn, as she uncovers the secrets of a world just out of reach but all around her. Turns out magic wasn't just a children's story. Genre: Young adult, High Fantasy, Adventure, Romance, Fae Folklore
Thrust (currently undergoing editorial changes/adding) by Tank_Girl
25 parts Complete
Leslie De Luca was a social outcast thanks to her ex-best friend Abby, has an absentee father who no less than disappeared off the face of the earth, and has an...eccentric aunt taking care of her. In her own eyes nothing less then normal, sort of, until a mysterious, very attractive boy named Adam shows up. She takes a liking to him quickly, but she is unaware of the trouble she is about to get into. Suddenly a once normal Leslie is thrust into a world of magic, secrets, death, and lies, where some powerful people want her dead, and she is supposed to keep the peace between worlds at only 17; but can she survive to see 17?
Royal blood by SundayAuthors
26 parts Ongoing Mature
A daughters quest for revenge sends her down a dark path of lies, murder, betrayal, deadly family politics, money, crime, love and obsession . A path she is more than willing to walk to correct the great injustice that she has suffered and seek vegence for all those she has lost ⚠️TW⚠️ There is content in the following that certain readers may not be comfortable reading, please proceed with caution viewer discretion is advised. The themes of this book are not suitable for younger audiences and may be considered to be heavy for some.
The Realms [Watty 2017 Shortlist] by RElizabethM
45 parts Complete
One mistake changes Hannah's life forever, exiling her from her realm and isolating her from the man who loves her. Now, Hannah must find a way to restore Ryan's memories and get them both back home before she loses everything forever. After threatening Ryan's father, the Ruler of the Realms, Hannah is transplanted into a new life in the Second Realm. Unable to get through to Ryan or to find her way back to her birth realm, Hannah enlists the help of Maizie, another banished soul who has some secrets of her own. Hannah knows that Ryan's father is abusing his power on the Third Realm and she intends to stop him, no matter the cost. Seeking out the Keepers of the Realms, Hannah and Maizie are drawn into a web of deception that leaves Hannah struggling to find the right path for herself and Ryan. Hannah's choices could save Ryan and the Third Realm but may leave her facing an uncertain future. What have people been saying about The Realms? *This book is awesome. I wish I could erase my memory of it and start it all over again - alubenlanretni *I loved this book - a3griffin32 *This is so amazing. You are truly talented - collettekozuchlepley *Love love loved this book! - shantelle721 *Loved the book! I was anxious to see what was coming next and was not disappointed when it did! - nicoleblakebontaine #5 in Adventure - January 26th, 2017 Third Place - 2016 Undiscovered Writers Awards in Adventure Featured story December 2016 - July 2017. Watty Awards Shortlist 2017 Cover by @pipo_here_
A Hand Weaving Chaos (Book 2 of The Fallen Gods Trilogy) by jan_claremont
36 parts Complete Mature
***{WATTYS 2022 SHORTLISTED}*** Jill Logan is plucked from everything she's come to care about, only this time, she's fallen into the hands of Prince Brexten's most powerful enemies, and they are determined to destroy her. There is treachery and manipulation on all sides and Jill has no idea who to trust. The only things she can rely on are her growing magical abilities and the will of the gods if she has any hope of surviving the tide of evil. But the gods are fickle and asking for their help isn't always a good idea. Soon Jill is swept up in a growing revolution as the people revolt against the sorcerers occupying their land. And as Jill's magical skills grow, some want to use her as a tool while others see her as a heretic. Suddenly the girl who believed in nothing-not even herself-will need to take a stand. And as her feelings are pulled between Prince Brexten and Aden, the First Lord Shey'na'shen, the land's most powerful magic wielder, will Jill be able to make the right choice to save both the land and her own heart? Sequel to IN THE SHADOW OF THE GODDESS
You may also like
Slide 1 of 7
The Chronicles of the Shadow-Realm - Part 1: Into the darkness cover
Death of the Ghost cover
The Bane of the Empire cover
Thrust (currently undergoing editorial changes/adding) cover
Royal blood cover
The Realms [Watty 2017 Shortlist] cover
A Hand Weaving Chaos (Book 2 of The Fallen Gods Trilogy) cover

The Chronicles of the Shadow-Realm - Part 1: Into the darkness

5 parts Ongoing

Martha, a shy 16-year-old girl living in Germany, is no fan of unnecessary risks - let alone adventures. But a school trip to the Berchtesgaden Alps quickly spirals into a nightmare... Will Martha manage to overcome her greatest fears and face epic challenges? Let yourself be drawn into the world of Alalea! Bloodthirsty monsters and nightmarish adventures await you in the Shadow Realm... This novel is just the beginning of an adventurous journey full of surprises...

More details