Story cover for What hurts most by hannamanroe
What hurts most
hannamanroe
  • WpView
    MGA BUMASA 4
  • WpVote
    Mga Boto 0
  • WpPart
    Mga Parte 1
  • WpHistory
    Oras <5 mins
  • WpView
    MGA BUMASA 4
  • WpVote
    Mga Boto 0
  • WpPart
    Mga Parte 1
  • WpHistory
    Oras <5 mins
hannamanroe
Ongoing, Unang na-publish Dec 08, 2019
alcoholboyscampingdramadrinkingfeelingsfeelshighschoolhighschoolexperiencehurtintercoursekisskissingloveromancesadsexualstoryswearingteenteenageteenlove
it's not just a few tears I cry because of you, it's the feeling of worthlessness and screaming at the moon. How can you be so in love with someone they have hurt you the most...
All Rights Reserved
alcoholboyscampingdramadrinkingfeelingsfeelshighschoolhighschoolexperiencehurtintercoursekisskissingloveromancesadsexualstoryswearingteenteenageteenlove
Table of contents

1 parte

Sign up to add What hurts most to your library and receive updates
o
#613boys
Mga Alituntunin ng Nilalaman
Magugustuhan mo rin ang
Someone Like Him ni nessa129
37 parte Kumpleto
We all have someone who is hidden in the bottom of our hearts. When we think of him, we will always feel a little pain inside, but still we can't forget about him. I can't forget about him because he is the one who makes me know what love is, and this is our love story. *COMPLETE/IN NEED OF MAJOR EDITING/SLOWLY EDITING* UPDATE: Rewritten New SLH is up on my account if you're interested! ©Nessa129 2014
Remember Me ni Writerandreader17
26 mga parte Kumpleto
Remember me when I'm gone. Teen romance Fantasy Hurt/Loss
Friend, Best Friend..SOUL MATE?! ni charll_louisee
29 mga parte Kumpleto
Bent Not Broken ni ShadowButterfly_786
12 parte Kumpleto Mature
You never know how dependent you are on someone until they leave... I loved my best friend in silence for years, one drunken confession brought my whole world crashing down.
Casual Intimacy ni bloomer5474
11 parte Kumpleto
He's a player. I'm a player. So it's only natural that we're best friends. We both share many of the same traits and hobby's. He can't stay with the same girl for more than 2 days, I can't stay with same guy for more than 2 days. We're both noncommittal teenagers, who both love to party. But, what happens when one night, we party a little too hard, and have a drunken night of lustful passion. And now can't keep our hands off of each other. Highest rankings 🥇#want! 🥇#benefits! 🥇#inlove! 🥇#player! 🥇#secretromance 🥇#alcohal
Dear Crush ni IcyStar_05
36 mga parte Kumpleto
It all started with a crush...
Circles | ✔️ ni CxTannir
54 mga parte Kumpleto Mature
[COMPLETE] They say weddings are eventful, to say the least. Anything could happen. What I didn't expect however, was him. My mistake. It's been years since we last spoke- he drives me crazy, in ways no one else has. Being back home and reunited with old friends, was about to get messy. ~ "Morning sleeping beauty," He drawled, leaning against the counter mixing his protein shake vigorously. "Well then you must be the beast and not the prince." I retorted, rummaging through the pantry for some granola I could have with greek yoghurt. "Yeah," he shrugged. I put my bowl and ingredients on the table and frowned. Did... he... just agree with me? "In the gym, in the office... and definitely in bed," he winked. Oh. There it was. He's so full of himself. I rolled my eyes, proceeding to make myself breakfast. It's too early for this. ~ Follow along as two individuals encounter each other once again as adults, whilst their teenage histories shadow over them with every step. Teen & New adult themes Started 19/11/18 - Finished 25/02/19 ❗️Contains explicit language and mature scenes. Reader discretion advised. This book is not to be copied or reproduced in any way.
My Addiction ni DemyaB
46 mga parte Kumpleto Mature
Teenage girl falls in love but it leads down the wrong path. Her life was changed drastically. (COMPLETED !!)
My best friends girlfriend ni bloomer5474
27 parte Kumpleto Mature
"It's fucked up I wanna kiss you huh" I whisper, looking at her lips. With her back against the wall, my body inches away from hers. "Noah, stop, we can't" she says, diverting her eyes. As she pressed her hands on my chest, pushing me away. I placed my hands on the wall on each side of her. "Then stop me" I softly whisper, leaning in...... Noah Montgomery is a 20 year old guy, in college. He is sarcastic, funny, sweet, handsome, flirt, and semi player. Who is attracted to his best friends girlfriend, Dani. Although he claims he would never act on this attraction. He can't help but to look at her, and think of her. And get slightly irritated when her boyfriend, even touches her. Danielle/Dani Monroe is a 20 year old girl, in college. She is a sweet, kind, caring, sarcastic, and a funny person. She has known Noah years before college, and met her boyfriend a few months before she graduated high school. She's alway felt something for Noah but shrugged it off as admiration. Now in their sophomore year of college, Dani moves in with her boyfriend. Who happens to already have roommate, that roommate being Noah. Now under the same roof. Can Noah ignore his attraction for his best friends girlfriend. Or will he give in to his desires. Will Dani realize the feelings she mistakes for admiration, are actually feelings of attraction. Or will they both go on as they have been, ignoring their feelings for one another. Read if you wanna find out! Mature rating is exaggerated! But, 16 an up. I suppose. 🥇in #kissme 🥇in #jealousy 🥇in #bestfriendsgirlfriend 🥇In #want
Drama,Love&Highschool(Sophomore Year) 🎭✨📗 ni CereliaM
12 parte Kumpleto Mature
With a mixture of love , drama,sex,violence and drugs , Princess and her crazy peers takes on a wild ride of 4 years of blood , sweat , tears , happiness , anger and regret , these teens faces many struggles and tragedies...but they try to over come their obstacles and learn from their mistakes, so see how all this craziness goes down in Drama,Love&High school.
Magugustuhan mo rin ang
Slide 1 of 10
Someone Like Him cover
Remember Me cover
Friend, Best Friend..SOUL MATE?! cover
Bent Not Broken cover
Casual Intimacy cover
Dear Crush cover
Circles | ✔️ cover
My Addiction cover
My best friends girlfriend cover
Drama,Love&Highschool(Sophomore Year) 🎭✨📗 cover

Someone Like Him

37 parte Kumpleto

We all have someone who is hidden in the bottom of our hearts. When we think of him, we will always feel a little pain inside, but still we can't forget about him. I can't forget about him because he is the one who makes me know what love is, and this is our love story. *COMPLETE/IN NEED OF MAJOR EDITING/SLOWLY EDITING* UPDATE: Rewritten New SLH is up on my account if you're interested! ©Nessa129 2014

Karagdagang detalye