Story cover for Wicked Game by _BackStabbath_
Wicked Game
_BackStabbath_
  • WpView
    Reads 2,288
  • WpVote
    Votes 535
  • WpPart
    Parts 19
  • WpHistory
    Time 1h 38m
  • WpView
    Reads 2,288
  • WpVote
    Votes 535
  • WpPart
    Parts 19
  • WpHistory
    Time 1h 38m
_BackStabbath_
Ongoing, First published Dec 27, 2019
adventureevilfantasyfirsthighfantasylovemagicmedievalmysteryprincessromanceroyalfamilysecretsstrongfemaleleadthrillervampirewarriorswitch
The Dark War brought to an end the reign of the witches. For a few years, the sky was blue and the bread was white, yet the transience of the peace was known to all. Decades later, evil stirs again. Far from the gates of Arlana, the last remaining kingdom of the elves, something unknown and sinister rises on the plains of Elderfrost.

When the birds return, Athena knows that the peace is over. With a faithful companion beside her, she must travel to Elderfrost, armed with a terrifying power she cannot control.

But nothing is as it seems. From the stone walls of Roselea and the marble palaces of Arlana to the cities of the Western Lands, there are many contenders who will stop at nothing to get what they want. Amid growing attractions, forbidden love, deceit, bloodshed, and a deadly disease that threatens to scorch the land and its people, can she fix the world around her, or will she break apart inside?

πŸ₯‡1st place in the Bloodstone awards (Fantasy category)
πŸ₯‰3rd place in the Fantasy Awards *Spring Edition* (Mystery/Thriller category)
πŸ₯‰3rd place in the Aphrodite Awards (Fantasy category)
All Rights Reserved
adventureevilfantasyfirsthighfantasylovemagicmedievalmysteryprincessromanceroyalfamilysecretsstrongfemaleleadthrillervampirewarriorswitch
Table of contents

19 parts

Sign up to add Wicked Game to your library and receive updates
or
Content Guidelines
You may also like
" The Last Note She Left " by HemaMercy
31 parts Complete Mature
Genre: Romance | Mystery | Drama ⚠ WARNING BEFORE YOU ENTER ⚠ This is not a love story. It's a story of secrets, betrayal, and the price of trust. Every smile hides a blade. Every embrace could be the last. The people you meet here are liars-even the dead ones. If you think you know the truth... you don't. Read carefully. Every chapter is a clue. Every word could save-or destroy-them. And when you finish, ask yourself only one question: Who would you trust when everyone wants you dead?
1. Amberstone | βœ“ by chrltt-t
50 parts Complete Mature
❝𝒂𝒔𝒕𝒓𝒂 π’Šπ’π’„π’π’Šπ’π’‚π’π’•, 𝒔𝒆𝒅 𝒏𝒐𝒏 π’π’ƒπ’π’Šπ’ˆπ’‚π’π’•.❞ (the stars incline us, they do not bind us.) ━━━━━━━━━━ π’ƒπ’π’π’Œ 𝒐𝒏𝒆 𝒐𝒇 𝒕𝒉𝒆 π’‚π’Žπ’ƒπ’†π’“π’”π’•π’π’π’† π’”π’†π’“π’Šπ’†π’” Born as twins, yet one of them had everything, and the other had close to none. Abandoned at birth, Elianna struggled to live in the cold desolated palace located in the deepest corners of Thethia's royal grounds, while her sister was crowned a Princess and showered with affections and luxury. Yet, Elianna was happy. She was surrounded by people who sincerely cared for her and having them is more than enough for her. The only question was, how long would this happiness last for her? ━━━━━━━━━━ Golden Awards 2020: Random Category - Honorable Mention ━━━━━━━━━━ 23.12.19: Completed | βœ“ 09.12.20: First Edit | βœ“
The Heir and the Undoing by ItsTheQuietGirls
18 parts Complete Mature
After one of the bloodiest battles in fae history, where a betrayal rocked the Light Court, Elora finds herself in a terrible position. To take the crown she was born to she must find a Consort to rule at her side. Tradition requires her to hold a tournament and allow Lords and Ladies from across the Isle to compete for her hand. Even if that means opening their doors to those of the opposing Court and coming face-to-face with family of the man who betrayed her brother. Without knowing who she can trust or how she will ever make a decision Elora is torn between making the right choice for her Court and the enigmatic Lord she has vowed to hate. With prophecies, notes, and an unknown power at her fingertips she soon realises that someone saw her on the battlefield that day and knows the truth about what happened. Siblings parted by centuries, One that will break us, Another that frees. A coming together to signal the end, One betrayed by a lover, One betrayed by a friend. ACOTAR X Reign Based on the ONC prompt: 96. "Was this a game to you?" Secondary prompts: 18. There was something inside me that wouldn't stop until the whole world was blood. 39. "Fine, make me your villain." - From 'Shadow and Bone' by Leigh Bardugo #ONC22 #tsc22 Featured on Wattpad @Fantasy June 2022
Veiled in Light and Ruin by jemicahcolleen
20 parts Ongoing
Every year, Lyra's village gathers beneath the ancient statues of the Fates, offering prayers and sacrifices to keep the creeping darkness at bay. The Ruined Kingdom stands in the distance, a forbidden place where no one enters and no one leaves. A place ruled by a king who does not age, does not die, and does not care for the world beyond his walls. Lyra has never believed in fate, only in survival. With her mother's health failing, she is willing to do whatever it takes to save what little she has left. But when this year's ritual goes terribly wrong, Lyra is taken-ripped from the life she knows and thrust into the heart of a kingdom lost to time. There, she is told she has been chosen. That she, along with others, must vie for the favor of a king no one has seen in over a century. But something is wrong within the castle's walls. Whispers of the past haunt her steps, and the King-cold, untouchable, and shrouded in secrets-watches her too closely. As shadows stir and forgotten magic awakens, Lyra begins to question everything she's been told about the Ruined Kingdom. And, more importantly, about herself. Because the deeper she delves into the mystery of the King and the kingdom he rules behind the walls, the more she realizes: Some destinies are written in blood. And some fates are meant to be broken.
Weaver's Curse by EClaireH
34 parts Complete
Indeara Vef can't remember anything. Quite literally. Everything before she woke up in the middle of nowhere is a blank slate. Perhaps the Weavers will provide a clue about her foggy past. Kaedwyn Telare-ess is on the run and has been since her banishment from her homeland when she was young. She doesn't know who she can trust, or even who is pursuing her, or why. Toby Reganne refuses to accept the path of arranged marriage that his family has picked for him. That snobby noblewoman can go jump in a lake. He'll find the life of adventure he's always wanted. Sedine Malachite lives in hiding, waiting for the day when the rest of the world finally declares her dead, and she can move freely in her home country again. Isaan is cursed. It wasn't hard to figure out. Not everyone wakes up some days only remembering fragments about themselves. The problem is, he can't even remember who might have cursed him. Two parties set out to find the mysterious Weavers; one led by a distant memory from what can only be another lifetime, the other led by a mysterious voice speaking in their leader's head.
A Quest to the Borat βœ” by anastarr1
65 parts Complete
We don't know what can happen to us in the next minute. We might smile, laugh, cry, hurt, or even die. But what you don't expect is to be transported into another dimension on the way back from school and be crowned the Queen of a magical nation called Eponine. "I now proclaim, Katarina Silvus Floarea, as High Queen of Eponine!" I hear as I feel the diamond-studded crown that I once admired be placed on my head. I stand up, holding the scepter, and the Golden Borat in my hands, and look at the crowd. These are my people. And I am their Queen. The most powerful Queen, ever in the millennium history of Eponine. And my friends stand beside me; I can see the pride in their eyes. To think, my name was Karen Hill, and I believed that I was a normal human is crazy. Because I was abandoned by my own father. Because finding the Borat was never easy. I found myself, I found my love, and I found the depth of my friendship with Iris and Kevin, and lastly, I found out what is betrayal. And it all started with a magic mirror! ***** First Draft | Beginner Story | May contain strong language | No sexual content | Slight Violence is depicted | |Fantasy | Romance | Mystery | 100, 000+ words
The Shattered Crown BOOK 1: CROWN OF ASH AND GOLD by Kira03353
9 parts Complete
Ember Valen has spent her life believing she was an ordinary young woman named Lola, she was raised by Beatrice, a quiet family friend with a mysterious past. But on her 21st birthday, Ember's world unravels. Strange magic erupts within her during a vivid dream, and her life takes a dark turn when she is captured and dragged into the magical realm of Aedralis. Here, Ember learns she is no ordinary human. She is a hybrid-the forbidden offspring of a fae prince and a powerful witch. Kael the soon to be king of the high fae. Uncover secrets of the past can she rise out of the ashes or is it the beginning of yet another war?
Beautiful Beast by lucyanneholland
35 parts Complete
My name is Kalista. They call me the beast. Kalista has been cursed by a powerful sorceress and is now a prisoner in her own palace. As petals fall from an enchanted rose, her fate and the sorceress's victory draw nearer. But Kalista refuses to be defeated so easily and uses her own magic to push against the bindings. Yet what if it is not enough and the only way the curse might be shattered is through the help of another? When Arawn crosses into the beast's domain, he has one motive: revenge for his brother's death. But as he draws nearer to the beast and is surrounded by invisible servants, magical banquets, and an enchanted forest, he realizes that this beast is much more complex and much more human than he first thought. As their paths intertwine, Kalista must risk opening her heart to another, while Arawn must learn to see past his hate and prejudice. Together, they struggle against spells, wolves, and time itself to break the curse. If they fail, Kalista will fall asleep and will never again wake.
Ashes of Eryndor by Bloodysher
16 parts Ongoing
SHE'S THE KNIGHT THEY TRUST. SHE'S THE CRIMINAL THEY FEAR. Torn between two lives, Althea is stranded on a world that isn't hers. By day, she serves as a loyal knight in the royal palace. By night, she is Nightblade, the empire's most wanted criminal, plotting its downfall. Her mission? To overthrow the Four Gods who destroyed her home planet and murdered her family. With her ruthless sister-in-all-but-blood, Vin, at her side, she will ignite a revolution from within the glittering court of Syphorite. But every move is a gamble. One wrong step, and her disguise will shatter. β—† A deadly game of political intrigue β—† A prophecy that terrifies even the gods β—† A sisterhood forged in secrets β—† The search for an ancient lost magic to get her home Will she free the worlds from the gods' tyranny, or will her past sins destroy her first?
You may also like
Slide 1 of 9
" The Last Note She Left " cover
1. Amberstone | βœ“ cover
The Heir and the Undoing cover
Veiled in Light and Ruin cover
Weaver's Curse cover
A Quest to the Borat βœ” cover
The Shattered Crown BOOK 1: CROWN OF ASH AND GOLD cover
Beautiful Beast cover
Ashes of Eryndor cover

" The Last Note She Left "

31 parts Complete Mature

Genre: Romance | Mystery | Drama ⚠ WARNING BEFORE YOU ENTER ⚠ This is not a love story. It's a story of secrets, betrayal, and the price of trust. Every smile hides a blade. Every embrace could be the last. The people you meet here are liars-even the dead ones. If you think you know the truth... you don't. Read carefully. Every chapter is a clue. Every word could save-or destroy-them. And when you finish, ask yourself only one question: Who would you trust when everyone wants you dead?

More details