Story cover for Solivagant by dreams_of_silver
Solivagant
dreams_of_silver
  • WpView
    LECTURAS 32,903
  • WpVote
    Votos 2,808
  • WpPart
    Partes 45
  • WpHistory
    Hora 10h 26m
  • WpView
    LECTURAS 32,903
  • WpVote
    Votos 2,808
  • WpPart
    Partes 45
  • WpHistory
    Hora 10h 26m
dreams_of_silver
Concluida, Has publicado ene 05, 2020
adventurealonechristianfantasycleandragondreamlandbooksfantasyhighfantasymagicmaleprotagonistmedievalnotsoromanticoutlawrealmofchristslinkawards2020solivagantsurvivalteenyoungadultyoungadultfantasy
Magic is to be feared. It is a wild, unpredictable thing, and anywhere it goes it brings mayhem and destruction. Those that wield it are even more dangerous.

At least, that's what King Soren claimed when he hunted down and killed nearly every magic-user in Eldernia. The only ones he spared were sworn into Soren's service as elite agents that have one purpose, and one purpose only--find any remaining magic-users and give them a choice. Join the Valkir . . . or die.

Asher, a sixteen-year-old boy, has managed to conceal his power for years. But when his secret is revealed, there will be no more hiding.


|| Winner of the 2020 Sinne Awards ||
|| Third place in the 2020 Black and Gold Flames Awards - Fantasy ||

The fabulous cover is from @-designdistrict !

NOTE: This book is NOT public domain, whatever Wattpad says. All rights are reserved.
Todos los derechos reservados
adventurealonechristianfantasycleandragondreamlandbooksfantasyhighfantasymagicmaleprotagonistmedievalnotsoromanticoutlawrealmofchristslinkawards2020solivagantsurvivalteenyoungadultyoungadultfantasy
Tabla de contenidos

45 partes

Regístrate para añadir Solivagant a tu biblioteca y recibir actualizaciones
O
#57outlaw
Pautas de Contenido
Quizás también te guste
Rhyshannon Chronicles | Book 1: A Path of Swords de Aravis-Brightspell
26 partes Continúa
On a day that began like any other, a fifteen-year-old boy lost everything he had ever valued--while gaining a Power that can shake the very foundations of two worlds. For David John Trent, nothing will ever be the same again after a near-death encounter with a cloaked assailant lands him in a hospital ICU. His reality starts to spiral out of control in what appears to be a never-ending nightmare, as he becomes the target of ancient, malevolent forces from another realm. David's only hope of survival rests in the hands of an exiled Druid who is shrouded in many secrets--and a Power that he can barely understand, let alone control. Thrust into the dark realm of Ervon, he now must walk a treacherous path of self-discovery--a path of swords--to face an immortal foe that threatens not only Ervon's existence, but the fate of his own world. ✧☽ ✧ 🗡 ✧ ☽ ✧ Laurel Wreath Awards 2023 Winner: Most Enthralling World Hall of Fame 2023 Awards 1st Place Winner: Adventure Sunset-Moon Awards 1st Place Winner: Action/Adventure Happiness Awards 2nd Place Winner: Fantasy/Adventure/Action ✧☽ ✧ 🗡 ✧ ☽ ✧ Cover Art by Aravis Brightspell
MAGE CHRONICLES: THE BEGINNING de GW_Merak1
26 partes Concluida Contenido adulto
Mahina thought her world was falling apart when she was kicked off the dance team, but that was just the beginning. Soon, she's pulled into a whirlwind of magic, danger, and a legacy she never wanted. Between navigating treacherous situations, discovering hidden powers, and facing enemies who want her gone, Mahina must learn fast-or lose everything. As betrayal lurks around every corner and romance ignites in the unlikeliest of places or people, Mahina's fate will be decided by choices she never thought she'd have to make. Will she rise to the challenge, or will this new world devour her whole? Dive into *Mage Chronicles: The Beginning* Book 1 in the Mage Chronicles Trilogy, and embark on a pulse-pounding journey filled with magic, intrigue, and heart-pounding action. Perfect for fans of epic fantasy with a modern twist.
Of Caverns and Casters ✓ [TLRQ #1] de avadel
78 partes Concluida
| 𝐖𝐚𝐭𝐭𝐲𝐬 𝟐𝟎𝟐𝟐 𝐒𝐡𝐨𝐫𝐭𝐥𝐢𝐬𝐭𝐞𝐝 • 𝗔𝗺𝗯𝘆𝘀 𝟮𝟬𝟮𝟮 𝗪𝗶𝗻𝗻𝗲𝗿 | ONE RUN-AWAY PRINCE Prince Aster Jacques will one day rule the Queen's Wizard Corps. By blood and every expectation, he should be a master spellcaster. Instead, he has all the skill of some second-rate, street-corner trickster. Desperate to be the wizard his beloved country needs, he'll do whatever it takes to learn the trade--even if that means abandoning his family to chase a mysterious academy invitation. TWO DIE-HARD SCIENTISTS Half a continent away, Leavi Riveirre and Sean Rahkifellar are researchers in the underground city of Karsix. For them, spells, princes, and kingdoms are nothing but children's stories. Reality is the relentless plague unleashing death and darkness in the city. Determined to survive what they can't cure, they flee--but reaching safety will require more than braving the harsh topside winter. A LAND THAT WASN'T SUPPOSED TO EXIST When brutal weather and betrayal force these three together, they'll find themselves questioning everything--and each other--to survive. WELCOME TO AVADEL. ~~~ 𝟔𝐱 Grand Winner 𝟐𝟐𝐱 First Place Fantasy Winner 𝟏𝟐𝐱 First Place Action/Adventure Winner 𝟏𝟓𝐱 Featured ~~~ The Lost Roads Quartet Book 1 Published on Amazon Cover Art © 2021 Avadel Ink Animated Banners by @Lazybrew
Raising a Hero de LoweFantasy
77 partes Concluida
She had only wanted to have a working marriage and a happy family. Despite that, her husband leaves her for another woman after the loss of their unborn child, and just as she starts to pick herself up, she dies in a car crash. But this isn't the end of her story. Her spirit is picked up by her brother, a beginner god who needs help raising the hero of his fledgling world. Thinking he is offering her an opportunity to be a mother, she readily agrees, and he sends her down to his world with the gift of healing and a semi-ageless body to aid her on her quest. She quickly finds her little boy and is overjoyed to have someone to baby at last. But this hero doesn't want her as his mother. He wants her as something else. DISCLAIMER!!! This is the first 77 chapters of a 241 chapter book! You can get it for cheapity cheap on Amazon (ebook and hardcopy) or pay by the chapter on other sites. It's called 'Google it.' I advise the Amazon route, because we poor folk need to stick together.
Extreme Heights (discontinued/read authors note) de C0ld_Karma
11 partes Concluida
Katsai Cree, a seventeen-year-old thief has done something she has always wanted to do. Steal from the King. Now on the run for her life, she must face her fear or risk losing it all to a tyrannical power. Kagin Lunern, a nineteen-year-old half-elf, just so happens to be dragged into it all. Following his friend of five years, Kagin must force down his emotions in order to keep her safe. Genesis Eral, a sixteen-year-old who has a unique gift, must come to terms with what happened in her past. But, there is one issue, she's alone. With our band of criminals, she must make the decision to either join them or remain in her solitude. Sonorus Balor, a twenty-year-old royal guard, is nothing more than just a guard. No magic, no courage, and most definitely no brawn. What happens when he is forced to track down this dangerous group of criminals? Follow four protagonists as they travel across magical and dangerous lands to escape the tyrannical hold of supreme power. These characters will have to face their fears along the way. Are you ready to face those fears along with them?
Mirror of Embers (Book 1) de Monkeygirl311
42 partes Concluida Contenido adulto
Ember Ryvergrave is tired and alone. Her mother is dead, her twin sister doesn't need her, and her best friend is in love with another. She feels as though she has no purpose anymore. She's a trained assassin. A killer. Surely she shouldn't be feeling so dejected from the people around her, yet those feelings linger deep inside her stomach. Along with the secret magic that resides in Ember's bones. The magic that would cost her her life if anyone knew about it. She's prepared to live a life of solitude and coldness until a strange boy with mint eyes and golden hair sees her and her magic. Ember's world flips upside down. He comes with news. Ember's fellow assassin has been taken. She has been tasked with retrieving the assassin and bringing them home. However, Ember has to cross through her country and go into the capital. Where the King resides. The man who wishes her dead. Though, she doesn't journey alone. The mint-eyed boy insists on coming. Now she must watch out for him . . . and herself. Trouble stirs and old demons come back to haunt Ember. Especially two men who are on the hunt for her. Ember's past is coming back to life and it's worse than anything she has ever imagined. Will she be able to save her fellow assassin? Or will she perish before she even reaches the capital? TWs: sexual assault, mentions of sexual assault, violence, gore, obscene language, depression, suicidal thoughts. Please take note of these before reading! 214K words *COVER ART IS NOT MINE* Len Yan is the artist of the cover, I got it off of pinterest!
The Thrill of the Hunt | ONC 2022 de elmaloney
18 partes Concluida
OPEN NOVELLA CONTEST - LONG LISTED Safety was never an option. She has nowhere to run. Nowhere to hide. Nowhere safe to reside. No matter how far she runs or how quiet she hides, they always find her. She will never be free of her hunters. Theresa knows this, yet she still tries. Theresa has a curse, one that makes her deadly to everyone and everything. She destroys anything she touches, and there is no way to stop it from consuming her surroundings. Not only is she wanted dead for her dark magic, but because she is one of them. A Naturian; and those aren't allowed to exist, not in this new age. But Theresa has always been running since her limbs let her, and she doesn't even know what she is. It's only when he comes, that she finally understands who she is, and that she isn't alone. But she doesn't find safety. Safety was never there. ➴➵➶➴➵➶➴➵➶➴➵➶➴➵➶ WARNING - this is a very violent and graphic book. It is not recommended for anyone under the age of sixteen. Cover made with an image from Pinterest // graphics by me Chapter covers made with an image from Pinterest // graphics by me RANKINGS: #04 in onc2022 - 16/02/2022 #05 in Hunting - 28/02/2022 #17 in Saviour - 16/02/2022 #39 in High Fantasy - 24/02/2022 #70 in Dark Fantasy - 16/02/2022 © elmaloney 2022 | all rights reserved
Argathripe - Book 2 ~ (The Dead City Series) de SKSuperKitty
25 partes Concluida
Book Two in The Dead City series. More books to come!! Hunter's been told he's one of the prophets. Okay... so he's going to save the world and be a hero and achieve his lifelong dream. But there's an unfortunate catch. Some people don't want there to be heroes. Some just want everything to stay the same. Some have twisted minds, and some could scare you so bad that you won't be able to fall asleep for a week. With both Grinesolians sick because of the darkness, and Scarlet, who doesn't even know how to control her powers yet, it's up to Hunter and a human to protect the prophets, three Royals, and all of Argathripe from these terrifyingly good assassins. They're finding out the hard way that The Eye sees everything-- especially the things you don't want anyone knowing.
White Stag (PERMAFROST #1) de Pandean
30 partes Concluida
Don't show fear. Don't attract attention. Don't forget who the monsters are. Those are seventeen-year-old Janneke's three rules to surviving in the Permafrost. Her family is dead, her village burned to the ground, and now she's a slave in a court of merciless goblins. Though her master, Soren, offers her a small sphere of protection, it comes at the cost of abandoning humanity and their ways for good. When the Goblin King is defeated in a fight, it ignites an ancient competition to become the next King. The goal is simple: kill the sacred White Stag before the other goblins kill you. Soren sees it as the perfect opportunity to shape Janneke's acceptance of the goblins' way and give in to the hatred and violence festering inside of her. Janneke's only hope for survival is to outrun, outfight, and out-kill every creature in her path, all the while dealing with Soren, whose fierce desire for her to be a goblin is shadowed by his fascination for her human heart. Hunting the Stag is Janneke's best chance at revenge over those who enslaved her, but to succeed, she'll have to watch her humanity bleed out like the creatures she's sworn to kill. **CREDIT FOR THE WONDERFUL COVER GOES TO @seventhstar *** ***COMPLETED. THE SEQUEL, GOBLIN KING, IS IN THE PROCESS OF WRITING AND POSTING. ENJOY!!!***
Warfire | Broken Time Series: Book Two de ShyGuySamurai
55 partes Concluida
Who knew one terrible mistake could trigger a war so quickly. It hadn't even been a few months, and news of the Kinsmen of the Dark gaining grounds constantly reached their ears. Every able body was requested by the Council of Thirds to join the front as an effort to push the darkness back. With Master Arcloven away and Carvolier shut down, all Nagan could do was sit and wait with the remaining Arclovens, hoping that the war would not reach their borders anytime soon. But what if Master Dagmire showed up at the Arcloven's doorstep with a heavy message in tow? Will Nagan agree to return to Carvolier? To be part of the emergency army currently being trained? Will he be able to resist the darkness following it? Book two of the Broken Time Series Started: Apr. 20, 2020 Completed: Dec. 31, 2022
Winter Ball: The Northern Academy de Sandra_Hartly
77 partes Concluida
When I enrolled at the Northern Academy of Magic, I never thought my first year would turn into a nightmare. A black dragon broke my heart, trampling my pride and humiliating me publicly. Years later, our paths crossed again. The arrogant inquisitor, sent by the Emperor's Council, has returned to destroy my world, shake the ground beneath my feet, and take away everything dear to me. But not this time, Mr. Inquisitor. I will fight for my life, and no dragon will stop me.
Nagan | Broken Time Series: Book One de ShyGuySamurai
49 partes Concluida
Who knew what would happen after stealing some bread from a street stall? Certainly not Nagan. Nothing out of the ordinary should have happened, considering stealing food to survive was the norm. But fate, destiny, karma, whatever you wanted to call it, had a funny way of showing mercy. Nagan didn't know what to think when a baby dragon dropped in front of him. Even stranger, it was there to deliver an invitation. Carvolier was calling to him, as was a larger-than-life destiny. Like father, like son, after all. Yet something darker seeped through the seams as his years in Carvolier went on. Only time knew what awaited him. Book one of the Broken Time Series BOOK ONE: Complete BOOK TWO: Complete BOOK THREE: In progress BOOK FOUR: Outlined || Featured on @StoriesUndiscovered Mar. 2021, Sep. 2021 || Started: Oct. 12, 2019 Completed: Apr. 6, 2020
MOFM 2: The Heir of Glass de Exequinne
28 partes Concluida
ELRED VALKALIN has one job: to ensure the annual feast goes according to plan to solidify her family's claim on the throne. With a series of isolated accidents occuring during the preparation, she is convinced someone is sabotaging her. In a territory where one misstep can erase one's reputation, Elred has to find who is behind the schemes and save her family's reputation in time. THE SECOND BOOK OF THE MEMOIRS OF MAYHEM NOVELLA SERIES ˜"°•.˜"°•˜"°•.˜"°•˜"°•.˜"°• © 2022 (First Edition) [25,000 - 30,000 words] WARNING: Make sure you read 𝘛𝘩𝘦 𝘊𝘩𝘳𝘰𝘯𝘪𝘤𝘭𝘦𝘴 𝘰𝘧 𝘍𝘢𝘯𝘵𝘢𝘴𝘪𝘭𝘪𝘢 Main Series first before continuing on to this story. The books can be found in a reading list in my profile, @Exequinne. [All graphics are made by @Exequinne]
The Golden Dragon's Hoard de STESLARA
31 partes Concluida
Astraeus, a baby dragon, escapes from his old coven and stumbles upon a little shop that he spends months stealing from and hiding in to survive. The witch and familiars who live there are... strange. They know he takes from them but don't put up different wards, don't do things that could hurt him. They know that he has a hide out in the aster tree, that he lives close-instead of getting rid of him and forcing him to move, they visit him. Talk to him, leave him things, they're kind. Different. Stranger than any other witch or familiar he's ever met. Stray is not used to things that don't hurt. The gentleness is terrifying. He'd rather stay away from them than learn why they don't have sharp tongues or bruised knuckles. However, on the night of a bad storm, he gets trapped inside of the shop, trapped with kind strangers. After getting caught, he discovers another dragon. He learns that life is not meant to be painful. He learns that he can be loved. He's allowed to want things with them. To eat, to not fear the cold, to live instead of survive. Everything changes and Stray is determined to make them his hoard, to make it complete.
The Dragon's Scale [COMPLETE] de Cross-Warrior
73 partes Concluida
|Book One of The Soul-Bound Chronicles| Classic J-RPG and anime elements collide with the Young Adult fiction writing style in this modern fantasy book following Josh Davidson, a teenage boy whose life flips upside down when he becomes soul-bound to a dragon ✧✧✧✧✧✧✧✧✧✧ Magic, heroes, dragons. Josh Davidson has seen it all-in video games and movies, of course, because they would never be anything but fiction. Yet his dreams are slipping into reality, he is experiencing sudden energy surges, and a persistent voice is taking residency in his head. All of the insanity explodes when his bully goes on a murderous rampage, and the only one who can stop him is a beautiful girl wielding a bow and shooting magical ice arrows. The experience leads Josh to the truth: he's a Paladin, someone soul-bound to a dragon. Not only does he now have a dragon reaching into his thoughts, but the new status comes with magical powers meant to help him in his fight against the forces of darkness. Josh is more than eager to hone his new skills and help the Paladins in their fight, but the darkness they face is rising from its slumber, intent on destroying the Paladins and everything they stand for. Josh will have to learn fast, because the most important decisions are those he cannot escape. Decisions that risk not only the war which the Paladins fight, but the very people he holds dear. ➢ Word Count: 130,000 - 135,000 ➢ Amazing cover made by Dayisdemigod ➢ Featured in Fantasy account's Young Adult Fantasy Reading List ➢ Featured in YASciFantasy account's Quests & Queens - Fantasy Adventure Reading List ➢ The Fiction Awards 2019 Best Fantasy Winner ➢ Editor's Pick Featured January 2021
Midnight Mage de Mahjabin12756
29 partes Concluida
In a world of supernaturals, I am something else. Ascension Day turned Average Joes into spell-casting savants, Plain Janes into glamorous vampires, and the homeless guy at the intersection of Sunset and Santa Monica into the alpha werewolf of Los Angeles. Unfortunately for me, my Ascension was... unique. I was struck by lightning and can't stop throwing sparks. For the last fourteen years, hiding has kept me safe from the government, while my uncle's magic has kept the public safe from me. Now, just when I've found some semblance of control over my power, my world turns upside down again. A terrorist organization has kidnapped my dad, thrusting me to the center of an investigation that quickly reveals my anonymity was only an illusion. Some of the most famous, dangerous supernaturals in the world surround me, and their agendas are as mystifying as my growing powers. My sworn protector is none other than Riven Thorne - arguably the oldest, most powerful vampire in existence. But even silver linings cast shadows; Riven has more secrets than I do. My name is Alfea Sullivan, and for better or worse, the world is about to find out exactly who I am.
TUW 4: Youth in the Light de Exequinne
21 partes Concluida
MALIN DRASWIST IS TOO YOUNG. With the advent of the new king of Cardina and the control of the state relinquished to Synketros, a covert organization bent on harnessing power, things took the turn for the worse. When soldiers start a siege against the Temple of Magic, the only place the oppressed can take refuge in, Malin has to devise a counterattack to save those dear to him. This time, he can't let his youth be a cause of their downfall. From the sprawling universe of 𝘛𝘩𝘦 𝘊𝘩𝘳𝘰𝘯𝘪𝘤𝘭𝘦𝘴 𝘰𝘧 𝘍𝘢𝘯𝘵𝘢𝘴𝘪𝘭𝘪𝘢, journey to hidden roads and forgotten paths in this brand new novella series set in the same universe and timeline as the main series. Be careful. There will be danger ahead. AN INSTALLMENT OF THE UNSEEN WARS NOVELLA SERIES ˜"°•.˜"°•˜"°•.˜"°•˜"°•.˜"°• © 2023 (First Edition) [20,000 - 25,000 words] WARNING: Make sure you read 𝘛𝘩𝘦 𝘊𝘩𝘳𝘰𝘯𝘪𝘤𝘭𝘦𝘴 𝘰𝘧 𝘍𝘢𝘯𝘵𝘢𝘴𝘪𝘭𝘪𝘢 Main Series first before continuing on to this story. The books can be found in a reading list in my profile, @Exequinne. [Cover by @Dayisdemigod]
Spell Broken de Ry-reader-29
30 partes Concluida
Lumi Fay's world has been turned upside-down once before, and now with her mentor turning up dead, it's flipped again. Only this time nothing beautiful can come from it. ~~~ Lumi is a protector in training. Her job is to learn how to protect the town, but when her mentor is found dead she is thrust into the job. Reeling from the heartache Lumi sets out to find the murderer. Not knowing anyone else with magic her list is empty. When she starts to suspect any and everyone, she starts to second guess everything she's ever known. When someone comes up to her asking for her help she can't say no. Little does she know the problems that will pop up if she helps. ~~ 6X Featured Book 1 of Witches of Roseborn Series Cover by @Dayisdemigod
Reincarnated As A Dragon Vol. 1: A New World, A New Life (Old) de Gabogame3
35 partes Concluida
Barry was a normal depressed teen in the middle of the COVID-19 pandemic. He has two siblings and a best friend. *UNKNOWN ANOMALY DETECTED* "Ahhh, the negative energy from his soul is strong indeed. What a candidate!" "Are you satisfied, Kalrusht?" "It's enough for my goals. For that, I thank you." "Just returning favours, demon." ***************************************** Barry's best friend commited suicide, and so did he, but before he knew it, he wasn't human anymore. He was a dragon! But not just any dragon, he became the lowest type of dragon there is, being in the lower levels of the food chain in a new world. In a world where there is the human lands, the demon lands, and the dog-eat-dog territory, he has to learn and adapt to this new world to survive. Magic thrives with all sides able to use magic. Mages run wild trying to meet public and royal demands while magical monsters live destroying, protecting, or conquering. Is meeting humans safe anymore? Is it safer to be in this forest full of monsters? WARNING: Story contains Profanity and a little gore. Highest Ranks (top 10s): 6 in #dragon (20/09/2021) 1 in #non-human (13/10/2021) 5 in #learning (04/04/2022) (why did this happen) 1 in #fantasyadventure (13/10/2021)
Quizás también te guste
Slide 1 of 19
Rhyshannon Chronicles | Book 1: A Path of Swords cover
MAGE CHRONICLES: THE BEGINNING cover
Of Caverns and Casters ✓ [TLRQ #1] cover
Raising a Hero cover
Extreme Heights (discontinued/read authors note) cover
Mirror of Embers (Book 1) cover
The Thrill of the Hunt | ONC 2022 cover
Argathripe - Book 2 ~ (The Dead City Series) cover
White Stag (PERMAFROST #1) cover
Warfire | Broken Time Series: Book Two cover
Winter Ball: The Northern Academy cover
Nagan | Broken Time Series: Book One cover
MOFM 2: The Heir of Glass cover
The Golden Dragon's Hoard cover
The Dragon's Scale [COMPLETE] cover
Midnight Mage cover
TUW 4: Youth in the Light cover
Spell Broken cover
Reincarnated As A Dragon Vol. 1: A New World, A New Life (Old) cover

Rhyshannon Chronicles | Book 1: A Path of Swords

26 partes Continúa

On a day that began like any other, a fifteen-year-old boy lost everything he had ever valued--while gaining a Power that can shake the very foundations of two worlds. For David John Trent, nothing will ever be the same again after a near-death encounter with a cloaked assailant lands him in a hospital ICU. His reality starts to spiral out of control in what appears to be a never-ending nightmare, as he becomes the target of ancient, malevolent forces from another realm. David's only hope of survival rests in the hands of an exiled Druid who is shrouded in many secrets--and a Power that he can barely understand, let alone control. Thrust into the dark realm of Ervon, he now must walk a treacherous path of self-discovery--a path of swords--to face an immortal foe that threatens not only Ervon's existence, but the fate of his own world. ✧☽ ✧ 🗡 ✧ ☽ ✧ Laurel Wreath Awards 2023 Winner: Most Enthralling World Hall of Fame 2023 Awards 1st Place Winner: Adventure Sunset-Moon Awards 1st Place Winner: Action/Adventure Happiness Awards 2nd Place Winner: Fantasy/Adventure/Action ✧☽ ✧ 🗡 ✧ ☽ ✧ Cover Art by Aravis Brightspell

Más detalles