Solivagant
dreams_of_silver
  • Reads 30,417
  • Votes 2,650
  • Parts 45
  • Time 10h 26m
  • Reads 30,417
  • Votes 2,650
  • Parts 45
  • Time 10h 26m
dreams_of_silver
Complete, First published Jan 05, 2020
adventurealonechristianfantasycleandragondreamlandbooksfantasyhighfantasymagicmaleprotagonistmedievalnotsoromanticoutlawrealmofchristslinkawards2020solivagantsurvivalteenyoungadultyoungadultfantasy
Magic is to be feared. It is a wild, unpredictable thing, and anywhere it goes it brings mayhem and destruction. Those that wield it are even more dangerous.

At least, that's what King Soren claimed when he hunted down and killed nearly every magic-user in Eldernia. The only ones he spared were sworn into Soren's service as elite agents that have one purpose, and one purpose only--find any remaining magic-users and give them a choice. Join the Valkir . . . or die.

Asher, a sixteen-year-old boy, has managed to conceal his power for years. But when his secret is revealed, there will be no more hiding.


|| Winner of the 2020 Sinne Awards ||
|| Third place in the 2020 Black and Gold Flames Awards - Fantasy ||

The fabulous cover is from @-designdistrict !

NOTE: This book is NOT public domain, whatever Wattpad says. All rights are reserved.
All Rights Reserved
adventurealonechristianfantasycleandragondreamlandbooksfantasyhighfantasymagicmaleprotagonistmedievalnotsoromanticoutlawrealmofchristslinkawards2020solivagantsurvivalteenyoungadultyoungadultfantasy
Table of contents

45 parts

Sign up to add Solivagant to your library and receive updates
or
#511alone
Content Guidelines
You may also like
Prophecy of the Flame - Book One by LynnHardy3
27 parts Complete
In a blinding flash of light, five strangers are yanked from this world and thrust into a land of sorcery as they are granted the looks and abilities of the people they were playing. This band of wannabe heroes soon discovers that having the powers they have always dreamed of, does not make life a dream come true. The Crusaders of the Light struggle to form a cohesive band as they blend twentieth century technology with the supernatural powers of this new world, fighting to liberate the kingdom of Cuthburan from the evil horde threatening humanity. Battle is also waged within Reba, an ordinary housewife who has become the most powerful mage on the planet, as she struggles to remain true to her wedding vows. Drawn against her will to the arms of Prince Alexandros, Reba must choose between a marriage to a handsome prince in a magical world or returning to the husband she left behind. * * A Glossary and a Character Glossary are included!
Midnight Mage by Mahjabin12756
29 parts Complete
In a world of supernaturals, I am something else. Ascension Day turned Average Joes into spell-casting savants, Plain Janes into glamorous vampires, and the homeless guy at the intersection of Sunset and Santa Monica into the alpha werewolf of Los Angeles. Unfortunately for me, my Ascension was... unique. I was struck by lightning and can't stop throwing sparks. For the last fourteen years, hiding has kept me safe from the government, while my uncle's magic has kept the public safe from me. Now, just when I've found some semblance of control over my power, my world turns upside down again. A terrorist organization has kidnapped my dad, thrusting me to the center of an investigation that quickly reveals my anonymity was only an illusion. Some of the most famous, dangerous supernaturals in the world surround me, and their agendas are as mystifying as my growing powers. My sworn protector is none other than Riven Thorne - arguably the oldest, most powerful vampire in existence. But even silver linings cast shadows; Riven has more secrets than I do. My name is Alfea Sullivan, and for better or worse, the world is about to find out exactly who I am.
Tears from the sky by Bdot424
19 parts Complete
" Dont let the fire fade my dear" Those words never made sense to Kallen no matter how many times he heard them. She always said he had a fire under his feet but he never understood why. Not until he was branded with a mark. A mark that came with a voice. One he couldn't get rid of and one he would have to live with. A voice that would lead him to a world he had never heard about. A world that was his and one he couldn't imagine exsisted. Kallen has been tasked to find the Seven pieces of the holy grail. This grail can grant whoever holds it any wish they may desire. No matter the cost, the price, or severity. Kallen will have help in the form of the Insignias but he must be aware that they are the hunted. He will be against the Court of Diamonds and they will stop at nothing to reform the grail as well. The Race has started and only one side can win, only one side shall win. The question of which side gets to win is what hangs in the balance Many have wandered in search of the grail and many have fallen victim to the wish they want granted. Who will be the one to bring the pieces together and what will that person wish for?
The Thrill of the Hunt | ONC 2022 by elmaloney
18 parts Complete
OPEN NOVELLA CONTEST - LONG LISTED Safety was never an option. She has nowhere to run. Nowhere to hide. Nowhere safe to reside. No matter how far she runs or how quiet she hides, they always find her. She will never be free of her hunters. Theresa knows this, yet she still tries. Theresa has a curse, one that makes her deadly to everyone and everything. She destroys anything she touches, and there is no way to stop it from consuming her surroundings. Not only is she wanted dead for her dark magic, but because she is one of them. A Naturian; and those aren't allowed to exist, not in this new age. But Theresa has always been running since her limbs let her, and she doesn't even know what she is. It's only when he comes, that she finally understands who she is, and that she isn't alone. But she doesn't find safety. Safety was never there. ➴➵➶➴➵➶➴➵➶➴➵➶➴➵➶ WARNING - this is a very violent and graphic book. It is not recommended for anyone under the age of sixteen. Cover made with an image from Pinterest // graphics by me Chapter covers made with an image from Pinterest // graphics by me RANKINGS: #04 in onc2022 - 16/02/2022 #05 in Hunting - 28/02/2022 #17 in Saviour - 16/02/2022 #39 in High Fantasy - 24/02/2022 #70 in Dark Fantasy - 16/02/2022 © elmaloney 2022 | all rights reserved
Crowns and Pawns by LizzieStars
41 parts Ongoing
This is the story of one whose destiny was predetermined. This is the story of one who was the victim of circumstance. A victim of a past that was not his own. He learned early to keep his head down, his mouth shut, his eyes up, and his ears open. He learned when to bite his gold and when to not look a gift horse in the mouth. He learned to judge malice from goodness. But nothing could have prepared him for what fate deigned to gift him. Another world; magic; plagues; blood and fire; royalty; and at every corner, lies. Jesse will need more than just power. He will need more than just skills and abilities. He will need help... and contacts. But in this game, who is trustworthy? And who is not? For one whose crime was to be born, to survive is to win.
Arise the Dragonslayer [⚔️The Flash warrior series #1⚔️] by mjcervanez
65 parts Complete
"THIS IS AN OLD VERSION OF MY WORK, THE NEW VERSION IS CALLED, 'DRAGONSLAYER AWAKENS'. GO CHECK IT OUT ON ROYALROAD.COM." "The first book of the fantasy-action-adventure series of The Flash warrior" The Flash warriors are heroes who formed together to protect the Enchanted world. However, they cannot defend it alone as they struggle against a dangerous three-headed dragon with immense capabilities. A hope shines, miraculously. And that is the sixteen-year-old MaXabiere Berrygrewd. He lives in a small village and is trained as a hunter. Little does he know an imminent doom awaits him, but not until a hidden power from within has awakened to combat against the horrifying fate. This is his beginning. With the warriors and not-so unlikely friends at his side, they must enter on a hunt to end the dragon's ultimate destruction. Soon the boy will be even more than just a young hunter- but a legendary Dragonslayer. 🏅Award🏅 🥉"Fantasy category" in Litwits award (8/24/19)- 3rd place @mjcervanez All Rights Reserved Copyright 2019
Bad Moon:Book One in the "I Am Chaos" series. by KTGale
16 parts Complete Mature
A Young Woman: Twenty-two year-old Eva Mallory has never felt truly herself. But that's normal, right? Especially given that her only remaining family member, her grandmother, is gone, and Eva has to navigate post-college life alone. And while most young women have to deal with the struggles of #adulting - roommates, new relationships, and work - they don't also have to deal with an edgy, electric feeling pulsing just beneath their skin. Recently, these strange feelings have gotten stronger. So have Eva's dreams, dreams full of energy, foreboding, and featuring her missing mother. A Secret World: It must be pure bad luck that causes Eva to stumble, one night, into a battle between a demonic madman and a powerful sorcerer. But she soon finds herself thrust into a violent world, at turns familiar and strange. It's a world where loyalty is demanded, alliances are tentative, and power is the ultimate currency. A Latent Power: As Eva finds herself used as a pawn between two cataclysmic forces, she realizes that her bad luck is no coincidence. Eva has no idea who she really is. And to survive, she must find out. But what if who she really is...is a monster?
Fire Born by Queeny_The_Horse
8 parts Ongoing
If you like low-stakes fantasy adventure books with a splash of slow-burn romance, this is the book for you! -- Growing up sickly and bedridden in a small mountain village, Aster never dreamed she could walk again, let alone save the world. Yet after curing her ailment, which was caused by her uncontrollable affinity for fire magic, she follows her new mentor, former Archmage Elric Shadowcaster, into the outside world. Haunted by the uncontrollable nature of her power, she is joined by unlikely allies and hunted by those who seek to control her power while she navigates the treacherous waters of politics, power, and betrayal. She will uncovering dark secrets and sinister plots that threaten to tear her kingdom apart.
Nagan | Broken Time Series: Book One by ShyGuySamurai
49 parts Complete
Who knew what would happen after stealing some bread from a street stall? Certainly not Nagan. Nothing out of the ordinary should have happened, considering stealing food to survive was the norm. But fate, destiny, karma, whatever you wanted to call it, had a funny way of showing mercy. Nagan didn't know what to think when a baby dragon dropped in front of him. Even stranger, it was there to deliver an invitation. Carvolier was calling to him, as was a larger-than-life destiny. Like father, like son, after all. Yet something darker seeped through the seams as his years in Carvolier went on. Only time knew what awaited him. Book one of the Broken Time Series BOOK ONE: Complete BOOK TWO: Complete BOOK THREE: In progress BOOK FOUR: Outlined || Featured on @StoriesUndiscovered Mar. 2021, Sep. 2021 || Started: Oct. 12, 2019 Completed: Apr. 6, 2020
Of Spellbooks and Thieves | SAMPLE by TheConfusedTurtle
9 parts Complete
Magic is a powerful yet fleeting thing. Those blessed with its presence are given a choice: to do good for their fellow man or to be corrupted. Tobias has neither magic nor the pressure of its power and has lived a peaceful, secluded life because of this. That is, before he stumbles across the key to power: a spellbook. Desperate to unlock its secrets, he accepts it as the promise of something greater. Until the day a thief snatches the book out from under him. In an effort to get it back, Tobias is thrust out into the dangerous world beyond the comfort of his home. Dragons, secrets, and wild magic lurk around every corner he turns, and he has no hope of catching the thief on his own. In order to reclaim his book and safely return home, Tobias must learn to adapt to the shifting world outside. But as he is joined by others who volunteer to aid him in his search for the thief, he realizes there's more to her than he thinks, and the spellbook is only the beginning. [𝟑𝐱 𝐅𝐞𝐚𝐭𝐮𝐫𝐞𝐝] ~~𝐍𝐨𝐰 𝐚 𝐩𝐮𝐛𝐥𝐢𝐬𝐡𝐞𝐝 𝐧𝐨𝐯𝐞𝐥 ~~Cover by @Penneywithaney
The Dragon's Scale [COMPLETE] by Cross-Warrior
73 parts Complete
|Book One of The Soul-Bound Chronicles| Classic J-RPG and anime elements collide with the Young Adult fiction writing style in this modern fantasy book following Josh Davidson, a teenage boy whose life flips upside down when he becomes soul-bound to a dragon ✧✧✧✧✧✧✧✧✧✧ Magic, heroes, dragons. Josh Davidson has seen it all-in video games and movies, of course, because they would never be anything but fiction. Yet his dreams are slipping into reality, he is experiencing sudden energy surges, and a persistent voice is taking residency in his head. All of the insanity explodes when his bully goes on a murderous rampage, and the only one who can stop him is a beautiful girl wielding a bow and shooting magical ice arrows. The experience leads Josh to the truth: he's a Paladin, someone soul-bound to a dragon. Not only does he now have a dragon reaching into his thoughts, but the new status comes with magical powers meant to help him in his fight against the forces of darkness. Josh is more than eager to hone his new skills and help the Paladins in their fight, but the darkness they face is rising from its slumber, intent on destroying the Paladins and everything they stand for. Josh will have to learn fast, because the most important decisions are those he cannot escape. Decisions that risk not only the war which the Paladins fight, but the very people he holds dear. ➢ Word Count: 130,000 - 135,000 ➢ Amazing cover made by Dayisdemigod ➢ Featured in Fantasy account's Young Adult Fantasy Reading List ➢ Featured in YASciFantasy account's Quests & Queens - Fantasy Adventure Reading List ➢ The Fiction Awards 2019 Best Fantasy Winner ➢ Editor's Pick Featured January 2021
TUW 4: Youth in the Light by Exequinne
20 parts Complete
MALIN DRASWIST IS TOO YOUNG. With the advent of the new king of Cardina and the control of the state relinquished to Synketros, a covert organization bent on harnessing power, things took the turn for the worse. When soldiers start a siege against the Temple of Magic, the only place the oppressed can take refuge in, Malin has to devise a counterattack to save those dear to him. This time, he can't let his youth be a cause of their downfall. From the sprawling universe of 𝘛𝘩𝘦 𝘊𝘩𝘳𝘰𝘯𝘪𝘤𝘭𝘦𝘴 𝘰𝘧 𝘍𝘢𝘯𝘵𝘢𝘴𝘪𝘭𝘪𝘢, journey to hidden roads and forgotten paths in this brand new novella series set in the same universe and timeline as the main series. Be careful. There will be danger ahead. AN INSTALLMENT OF THE UNSEEN WARS NOVELLA SERIES ˜"°•.˜"°•˜"°•.˜"°•˜"°•.˜"°• © 2023 (First Edition) [20,000 - 25,000 words] WARNING: Make sure you read 𝘛𝘩𝘦 𝘊𝘩𝘳𝘰𝘯𝘪𝘤𝘭𝘦𝘴 𝘰𝘧 𝘍𝘢𝘯𝘵𝘢𝘴𝘪𝘭𝘪𝘢 Main Series first before continuing on to this story. The books can be found in a reading list in my profile, @Exequinne. [Cover by @Dayisdemigod]
Extreme Heights (discontinued/read authors note) by C0ld_Karma
11 parts Complete
Katsai Cree, a seventeen-year-old thief has done something she has always wanted to do. Steal from the King. Now on the run for her life, she must face her fear or risk losing it all to a tyrannical power. Kagin Lunern, a nineteen-year-old half-elf, just so happens to be dragged into it all. Following his friend of five years, Kagin must force down his emotions in order to keep her safe. Genesis Eral, a sixteen-year-old who has a unique gift, must come to terms with what happened in her past. But, there is one issue, she's alone. With our band of criminals, she must make the decision to either join them or remain in her solitude. Sonorus Balor, a twenty-year-old royal guard, is nothing more than just a guard. No magic, no courage, and most definitely no brawn. What happens when he is forced to track down this dangerous group of criminals? Follow four protagonists as they travel across magical and dangerous lands to escape the tyrannical hold of supreme power. These characters will have to face their fears along the way. Are you ready to face those fears along with them?
Slate Gray by alpaljames
40 parts Ongoing Mature
For the Slates, Demon Slaying is the family business. And eighteen-year-old Perrin has fully embraced her chosen profession. But when her younger sister, fifteen-year-old Ace, unwittingly picks a doozy of a case as her first outing, they discover their connection to a demonic bet one thousand years in the making. Along with their exasperated father and an overeager, yet extremely cute grocery store clerk, Perrin and Ace will need to trust each other and their training in order to avoid setting off a chain of events that some might deem apocalyptic. Will Perrin lose herself trying to keep her family safe? Will Ace make a deal with the devil that ruins both their lives? Only time will tell. Accolades: 🥇1st Place in the 2024 Nova Nexus Awards for BEST WRITING STYLE 🥇1st Place in the 2024 Open Door Awards for BEST DIALOGUE 🥇1st Place in the 2024 Gloria Regali Awards for BEST VILLAIN 🥇1st Place in the 2024 Grand Masquerade of Writing for BEST ANTAGONIST 🥇1st Place in the 2024 Bloomers Awards for BEST BONDING 🥇1st Place in the 2024 Cloud Awards for ACTION/ADVENTURE 🥇1st Place in the 2024 Grand Masquerade of Writing for PARANORMAL/SUPERNATURAL 🥇1st Place in the 2024 Gloria Regali Awards for PARANORMAL 🥇1st Place in the 2024 Fantasy Awards for PARANORMAL 🥇1st Place in the 2024 Ocean Yellow Awards for PARANORMAL/HORROR 🥇1st Place in the 2024 Celestial Nexus Awards for HORROR 🥇1st Place in the 2024 Elpida Awards for HORROR Featured on: @Fantasy @CelestiaCove @CitifiedFantasy @HalosAndHellfires @JustWriteIt @PrideReads @Project_Athena @QuickFantasy @StoriesUndiscovered **Trigger Warnings for Language, Violence and Gore**
Of Caverns and Casters ✓ [TLRQ #1] by avadel
78 parts Complete
| 𝐖𝐚𝐭𝐭𝐲𝐬 𝟐𝟎𝟐𝟐 𝐒𝐡𝐨𝐫𝐭𝐥𝐢𝐬𝐭𝐞𝐝 • 𝗔𝗺𝗯𝘆𝘀 𝟮𝟬𝟮𝟮 𝗪𝗶𝗻𝗻𝗲𝗿 | ONE RUN-AWAY PRINCE Prince Aster Jacques will one day rule the Queen's Wizard Corps. By blood and every expectation, he should be a master spellcaster. Instead, he has all the skill of some second-rate, street-corner trickster. Desperate to be the wizard his beloved country needs, he'll do whatever it takes to learn the trade--even if that means abandoning his family to chase a mysterious academy invitation. TWO DIE-HARD SCIENTISTS Half a continent away, Leavi Riveirre and Sean Rahkifellar are researchers in the underground city of Karsix. For them, spells, princes, and kingdoms are nothing but children's stories. Reality is the relentless plague unleashing death and darkness in the city. Determined to survive what they can't cure, they flee--but reaching safety will require more than braving the harsh topside winter. A LAND THAT WASN'T SUPPOSED TO EXIST When brutal weather and betrayal force these three together, they'll find themselves questioning everything--and each other--to survive. WELCOME TO AVADEL. ~~~ 𝟔𝐱 Grand Winner 𝟐𝟐𝐱 First Place Fantasy Winner 𝟏𝟐𝐱 First Place Action/Adventure Winner 𝟏𝟓𝐱 Featured ~~~ The Lost Roads Quartet Book 1 Published on Amazon Cover Art © 2021 Avadel Ink Animated Banners by @Lazybrew
Argathripe - Book 2 ~ (The Dead City Series) by SKSuperKitty
25 parts Complete
Book Two in The Dead City series. More books to come!! Hunter's been told he's one of the prophets. Okay... so he's going to save the world and be a hero and achieve his lifelong dream. But there's an unfortunate catch. Some people don't want there to be heroes. Some just want everything to stay the same. Some have twisted minds, and some could scare you so bad that you won't be able to fall asleep for a week. With both Grinesolians sick because of the darkness, and Scarlet, who doesn't even know how to control her powers yet, it's up to Hunter and a human to protect the prophets, three Royals, and all of Argathripe from these terrifyingly good assassins. They're finding out the hard way that The Eye sees everything-- especially the things you don't want anyone knowing.
White Stag (PERMAFROST #1) by Pandean
30 parts Complete
Don't show fear. Don't attract attention. Don't forget who the monsters are. Those are seventeen-year-old Janneke's three rules to surviving in the Permafrost. Her family is dead, her village burned to the ground, and now she's a slave in a court of merciless goblins. Though her master, Soren, offers her a small sphere of protection, it comes at the cost of abandoning humanity and their ways for good. When the Goblin King is defeated in a fight, it ignites an ancient competition to become the next King. The goal is simple: kill the sacred White Stag before the other goblins kill you. Soren sees it as the perfect opportunity to shape Janneke's acceptance of the goblins' way and give in to the hatred and violence festering inside of her. Janneke's only hope for survival is to outrun, outfight, and out-kill every creature in her path, all the while dealing with Soren, whose fierce desire for her to be a goblin is shadowed by his fascination for her human heart. Hunting the Stag is Janneke's best chance at revenge over those who enslaved her, but to succeed, she'll have to watch her humanity bleed out like the creatures she's sworn to kill. **CREDIT FOR THE WONDERFUL COVER GOES TO @seventhstar *** ***COMPLETED. THE SEQUEL, GOBLIN KING, IS IN THE PROCESS OF WRITING AND POSTING. ENJOY!!!***
Of Whispers and Daggers ✓ [TLRQ #2] by avadel
109 parts Complete
| 𝐖𝐚𝐭𝐭𝐲𝐬 𝟐𝟎𝟐𝟐 𝐒𝐡𝐨𝐫𝐭𝐥𝐢𝐬𝐭𝐞𝐝 • 𝐀𝐦𝐛𝐲𝐬 𝟐𝟎𝟐𝟒 𝐖𝐢𝐧𝐧𝐞𝐫 | RUTHLESS POLITICS Aster Jacques' predecessor is dead, his capital ruined, and his people struggling to fight back against their most hated enemy. Determined to save the country he loves, he prepares to take the throne he fears. Upon returning home, though, the Ladies of the court connive to make him more puppet than prince. DEADLY SECRETS As he fights to untangle their web of lies, he finds a far more frightening truth-someone in the castle hides a traitorous secret. Unsure who to trust, he swears to forge his path alone. But when a vengeful witch offers him a deal and the girl he cares for tangles herself into the danger, he'll be forced to befriend darknesses he'd rather run from than face. A LAND THAT WAS SUPPOSED TO BE UNCONQUERABLE From within and without, Aster's world teeters on the brink of collapse. When lies, love, and war collide, even magic won't be enough to save everyone. WELCOME TO MORINEAUX ~*~ Book 2 of the Lost Roads Quartet. See Of Caverns and Casters for Book 1. Published on Amazon. Cover Art © 2021 Avadel Ink Animated Banners by @Lazybrew
You may also like
Slide 1 of 18
Prophecy of the Flame - Book One cover
Midnight Mage cover
Tears from the sky cover
The Thrill of the Hunt | ONC 2022 cover
Crowns and Pawns cover
Arise the Dragonslayer [⚔️The Flash warrior series #1⚔️] cover
Bad Moon:Book One in the "I Am Chaos" series. cover
Fire Born cover
Nagan | Broken Time Series: Book One cover
Of Spellbooks and Thieves | SAMPLE cover
The Dragon's Scale [COMPLETE] cover
TUW 4: Youth in the Light cover
Extreme Heights (discontinued/read authors note) cover
Slate Gray cover
Of Caverns and Casters ✓ [TLRQ #1] cover
Argathripe - Book 2 ~ (The Dead City Series) cover
White Stag (PERMAFROST #1) cover
Of Whispers and Daggers ✓ [TLRQ #2] cover

Prophecy of the Flame - Book One

27 parts Complete

In a blinding flash of light, five strangers are yanked from this world and thrust into a land of sorcery as they are granted the looks and abilities of the people they were playing. This band of wannabe heroes soon discovers that having the powers they have always dreamed of, does not make life a dream come true. The Crusaders of the Light struggle to form a cohesive band as they blend twentieth century technology with the supernatural powers of this new world, fighting to liberate the kingdom of Cuthburan from the evil horde threatening humanity. Battle is also waged within Reba, an ordinary housewife who has become the most powerful mage on the planet, as she struggles to remain true to her wedding vows. Drawn against her will to the arms of Prince Alexandros, Reba must choose between a marriage to a handsome prince in a magical world or returning to the husband she left behind. * * A Glossary and a Character Glossary are included!

More details