Story cover for Snaps and fangs (Wednesday Addams x male vampire reader) by HedgehogsharkBarry
Snaps and fangs (Wednesday Addams x male vampire reader)
HedgehogsharkBarry
  • WpView
    Reads 99,828
  • WpVote
    Votes 1,822
  • WpPart
    Parts 9
  • WpHistory
    Time 24m
  • WpView
    Reads 99,828
  • WpVote
    Votes 1,822
  • WpPart
    Parts 9
  • WpHistory
    Time 24m
HedgehogsharkBarry
Ongoing, First published Feb 11, 2020
addamsfamilyvampirewednesdayaddams
Contains content not for kids. Well, even if you were a kid you'd read it anyway. So, no point in the warning. Just enjoy your virginity.

I'm gonna use second-person point of view words like "You"

DISCLAIMER: The author is a virgin

*Smut*

*TRIGGER WARNING* (Unless you're masochistic)

This is cursed content ;_;
All Rights Reserved
addamsfamilyvampirewednesdayaddams
Table of contents

9 parts

Sign up to add Snaps and fangs (Wednesday Addams x male vampire reader) to your library and receive updates
or
#32addamsfamily
Content Guidelines
You may also like
Sturniolo Triplets sickfics by astrolliogic
37 parts Complete Mature
Says it in the title. if they are uncomfortable with with then i will delete it. No smut or Y/n, because as an asexual person, I hate smut, and also the triplets have made it clear that they are uncomfortable with it. I also will not be writing about r@pe or sexu@l assault because those are triggers to me. trigger warnings will be in the chapters!!
Maybe??🤔 by HerRoyalRachet-ness
29 parts Ongoing Mature
just read it trust me it's good love😘
Savior by IceQueen713
18 parts Complete Mature
: Book 1 : :TRIGGER WARNING:PLEASE READ: trigger warning I will not give any further warning it ruins the atmosphere this story will have topics for a mature audience such as possible lemon rape death slight Gore cursing and is recommended for 18+ or you may read at your own risk. Disclaimer: I Don't own Markiplier/Darkiplier Jacksepticeye/Antisepticeye and NONE of the Artwork or Photo's are Mine they are off of a Public Domain such as Twitter/Facebook. Thank You ♡
timothée chalamet imagines by beauty200345
190 parts Complete Mature
Timothée Chalamet imagines 💗 !!REQUESTS ARE CLOSED!! * = smut, events leading to smut/events after smut, and mentions of mature content. I'm not a writer, but this is what I can do! Frequent updates at best :)
𝐓𝐀𝐒𝐓𝐄 𝐎𝐅 𝐋𝐔𝐒𝐓 | 𝟏𝟖+ by Bliswrite
33 parts Complete Mature
𝐓𝐀𝐒𝐓𝐄 𝐎𝐅 𝐋𝐔𝐒𝐓 ᥫ᭡ 𝑩𝑶𝑶𝑲 𝑰 "𝑰'𝒎 𝒈𝒐𝒊𝒏𝒈 𝒕𝒐 𝒕𝒓𝒆𝒂𝒕 𝒚𝒐𝒖 𝒂𝒏𝒅 𝒇𝒖𝒄𝒌 𝒚𝒐𝒖 𝒍𝒊𝒌𝒆 𝒎𝒚 𝒘𝒊𝒇𝒆. 𝑶𝒏𝒄𝒆 𝑰'𝒎 𝒊𝒏𝒔𝒊𝒅𝒆 𝒚𝒐𝒖, 𝒊𝒎 𝒚𝒐𝒖𝒓𝒔" - 𝐋𝐮𝐜𝐚 𝐃𝐨𝐦𝐢𝐧𝐢𝐜𝐨 ᥫ᭡
Why Dont We Imagines BxB by jordannlea
27 parts Complete Mature
WARNING SMUT MAYBE INCLUDED. If you do not like boyxboy relationships dont read this.
Heart squeeze (Wednesday x Xavier) by Iwant_aPeter
27 parts Complete Mature
"I wasn't made for love." "You weren't made for everyone's love...but you were made for mine." {~••~} Nevermore presents many opportunities. Stalkers. Revenge perhaps? Wednesday Addams gets caught in the middle of it all, and it doesn't help that feelings begin circling around her like vultures on a carcass. Backstabbers and deaths. Attacks and love. Heart squeezes. Can Wednesday save herself? [~•~] Warnings: Wednesday x Xavier story, slow burn (hopefully), some mature content but no smut. Yuck. There will be blood and slightly gory things, mentions of anxiety, depression and drugs, if such content makes you uncomfortable I suggest you not read. I tend to get off track at times.l
Insecurities [A Your Boyfriend Fanfic] by TickVoidian
9 parts Complete
This is going to suck and I'm looking forward to it lol. This is an 18+ game, so there's gonna be 18+ stuff. No smut. Get out of here horny fuks. Jkjk. If people who read this (doubt it) want smut, I might do it. But, I'm more here to help my writers block and for the gore. Also there will be some uncomfortable moments that involve some 18+ stuff because it happens in the game. I hate it as much as you do, trust me. TW: This fanficion is based on an NSFW RPG Horror game. There will be some stuff that isn't suitable for children and things that could be triggering. But, let's face it, if you're here, you read the title, and you probably don't care. Y/N is a chubby male with insecurities, hints the title. Ships: Y/N X T.K. Y/N X Peter (of course it's a Your Boyfriend fanfiction.)
HIS ADDICTIVE DESIRES by itsdollyyyy
26 parts Ongoing Mature
MATURE CONTENT!!!!!!!!!! 18+ 🔞🔞🔞 Warning this is totally going to be a mature content read it at your own will if your are going to be under 18!
moments for escape by shinobulov3rr
79 parts Ongoing Mature
for the ones you still think about, for the things you wish you said. not everything was meant to last, yet the memory does.
You may also like
Slide 1 of 10
Sturniolo Triplets sickfics cover
Maybe??🤔 cover
Savior cover
timothée chalamet imagines cover
𝐓𝐀𝐒𝐓𝐄 𝐎𝐅 𝐋𝐔𝐒𝐓 | 𝟏𝟖+ cover
Why Dont We Imagines BxB cover
Heart squeeze (Wednesday x Xavier) cover
Insecurities [A Your Boyfriend Fanfic] cover
HIS ADDICTIVE DESIRES cover
moments for escape cover

Sturniolo Triplets sickfics

37 parts Complete Mature

Says it in the title. if they are uncomfortable with with then i will delete it. No smut or Y/n, because as an asexual person, I hate smut, and also the triplets have made it clear that they are uncomfortable with it. I also will not be writing about r@pe or sexu@l assault because those are triggers to me. trigger warnings will be in the chapters!!

More details