Evil
youkuxiaobb
  • Reads 358
  • Votes 101
  • Parts 26
  • Time 2h 36m
  • Reads 358
  • Votes 101
  • Parts 26
  • Time 2h 36m
youkuxiaobb
Ongoing, First published Mar 09, 2020
Mature
adventurecrimedarkdarkthemedeathempirefantasyfictionfunnyhumormagicmulticharactermysterypovrebellionsuperherosupernaturalsuperpowersthriller
He used the "Book of the Heart" to sell "evil" and used the wisdom of the world to lay out articles. The Fifth Kingdom of the Earth-the Kingdom of Mankind, a story that took place in 2100.
A huge empire used absolute force to destroy national borders, nations, and beliefs, and built a hierarchical society of "royal-noble-civilians.
The Imperial Palace, "SkyCity", was built at a height of more than 4,000 meters from sea level. Here are the most advanced technologies of mankind, no matter the sea level rise, the crust changes, the climate change, the outbreak of nuclear war, or the outbreak of viruses, it will not pose a threat to it, except for a bookstore owner named Tian.
Rebellion organizations such as the Iron Commandment, the Frontline of Freedom, Xingtian, and the Anti-Cross were dispatched.
All Rights Reserved
adventurecrimedarkdarkthemedeathempirefantasyfictionfunnyhumormagicmulticharactermysterypovrebellionsuperherosupernaturalsuperpowersthriller
Table of contents

26 parts

Sign up to add Evil to your library and receive updates
or
Content Guidelines
You may also like
The Greatest Warlord by Bagja_william
18 parts Ongoing
Two thousand years have passed since The Evil King's reign. A young man awakens from his long, deep slumber of perpetual nightmares. He was once The Evil King's Greatest Warlord. Confused, he has lost all memory of his past life, including The Evil King's identity and the reason why he served him. The only thing he remembers is his time spent with his colleagues as The Evil King's Warlord. The wound from his defeat by The Heroes makes him unable to forgive himself, leading him to give in to the hatred he long harboured. This created the perpetual nightmare he has suffered through for 2,000 years. Anger, sadness, and hatred have fused into one, living on inside the man he once was. He accepts his second chance at life when he awakens in front of a lady who was once his colleague. Together, they live peacefully and search for the meaning of the new life granted to him by The Evil King. Until then, the stars falling from the sky, bringing daylight to the night and enlivening the city. Once again, The Young Man sees the greed in human nature. Leading him to another chaos and destruction in the name of justice.
Terra Preta by ramose_xiv
14 parts Ongoing Mature
In 2027, everything changes when a strange comet lights up the night sky. At first, people are just spooked, but when it crashes, the real nightmare kicks in-an alien virus starts spreading, pushing evolution into overdrive. The world goes wild as nature mutates beyond recognition, and it's revealed that this is no random disaster. It's part of a massive experiment by an alien race called the Korathians, who've been running this test for millennia, just to see how far life can evolve. And now, Earth is their latest lab. As the virus transforms creatures into monsters, humanity struggles to survive. People aren't just battling these new beasts-they're also fighting to keep hold of what makes them human. The lines between who's human and who's not blur, and everyone is caught in a game they never asked to play.
Forgotten by crystalbooks24
54 parts Complete Mature
//He had my hands pinned tightly above my head as I squirmed beneath him. The blade twisting between his fingers. He held it up to my throat. I was afraid but refused to show it. "Hurt me." I said between gritted teeth. He just gave me a sorrowful glance before driving the dagger into my flesh.// This is no story of love and happiness. This is a story of death and destruction. One of a man and woman who met one night and not only changed the lives of themselves, but the lives of a whole world of people. One was fire and one was water. They were perfectly balanced. Until one night when the sun fell just below the tip of the tallest castle, the balance faltered, and all hell broke loose. Fire on fire. This is no memorable story that was told on for generations after. No. This is a story of the forgotten. ------------------------------------------- The prince and princess are forced to marry out of their fathers hatred for one another. Yet, there's a falter to the plan and murder gets involved. Will the two be able to put aside years of pent up hatred, or will love conquer all? Socials: @0fficialcrystalwebb on tiktok
G.H.O.S.T.: The Vaknar War by Shirotense
29 parts Complete
The world has changed a lot since the end of the Dark Lady's reign. Superpowered individuals are still feared by many, but the first intelligence agency made up of powerful beings and regular agents have been successfully protecting the world for almost a decade now. Xavier Bridger and his fellow agents at G.H.O.S.T. have been at the forefront of this mission, taking down dangerous villains with ease. However, whispers of a security breach at G.H.O.S.T.'s new space station have started to spread, making everyone wonder what the future holds for the organization. Not to mention a foreboding mystery from one of their one. Secrets revealed, bonds broken, cities in eternal fire. As an uncertain future looms, the question remains: Will they prevail under pressure? Only time will tell.
The Final Countdown - Season I by JWCMaher
41 parts Complete
Four intrepid explorers...no, not quite...adventurers...no, wrong again... Sorry. The Earth blows up. Only four people knew about it. This is their story. _____________________________________ Huge, big, enormous thanks to @writtenbyjkgomes for this amazing new cover!
Expanded Horizons: Beyond the Blue by ThetaObelusGamma
41 parts Complete
The world consists of far more than a few people, and far more than just what you see of them now. All characters have a past, a story, some piece of themselves hidden by time that makes clear who they are today. These hidden aspects can be revealed by more than just their stories, too; sometimes, what happens off-screen is even more important than what's on display. Follow me through the world our heroes and villains inhabit and see just how far we can go together! -This is all backstory and world-building for the Freelands of Into That Wild Blue Yonder (https://www.wattpad.com/story/214070883-into-that-wild-blue-yonder). Just around 50K words. -I also wrote up a brief encyclopedia with general world info here (https://www.wattpad.com/story/216689041-a-brief-encyclopedia-of-the-reimagined-world). Contains no spoilers.
Elven Legacy (Part 2) by 0zonelayer1
164 parts Ongoing Mature
If you are interested in Cultivation novels but tired of the same plot with MC always starting from the bottom and working his way up, come and read this novel, you may find it to your liking. Somewhere in the vast expanse called the OverRealm existed an Empire that governed trillions and trillions of citizens with a domain of an even more significant magnitude. It was a typical morning for most people, except for the Royal Family that controlled the Empire. Somewhere inside the enormous palace, a child was being born, a child of never-seen-before talents, a child who was born with everything anyone could possibly ask for. Now, let us follow the child's journey and see how they will adapt, experience, and change the OverRealm in the future.
Legend of The Godkids [Published] by ZachPaquette
67 parts Complete
Long ago, humans with supernatural abilities began to appear in our world. These gifted humans possessed strange powers such as super strength, the ability to fly, or control over elements. However, these gifted humans were few in number. Soon, the normal humans grew jealous of their power. They shamelessly threw these "freaks" out of their homes. They were beaten, abused, and treated as slaves. Eventually, the gifted humans rebelled, and a great war began between them. This war would last for years and lead to countless lives lost. Realizing they could never coexist, the gifted humans decided to create a world where they could live freely. This world became known as Trabachi. Hundreds of years later, enter our main character. Luke Sky lives on Earth, where people had long forgotten about the great war and gifted humans. He receives a letter inviting him to Trabachi. There he discovers that what he once thought was impossible was actually possible. He finds out that not only does he have awesome super powers, but he is the chosen hero the entire kingdom has been waiting for. For not every Trabacian has forgiven the humans for what they did to their ancestors. And they are ready to take revenge on them all. -------------------------------------------------- Update! This book is now a published work! You can buy it on Amazon here: http://www.amazon.com/Legend-Godkids-Zachary-Paquette/dp/1522991042/ref=sr_1_1?ie=UTF8&qid=1452555883&sr=8-1&keywords=legend+of+the+godkids It would be awesome if you checked it out! This version has more content so if you want to see more of Luke and the gang, buy the book! Thanks again! Happy Reading! -Zachary Paquette
Build A Scientific And Technological Civilization by Sokdavid123
174 parts Ongoing
Alexander Sebastian had transmigrated to a world where everyone could awaken a Planet. The larger the Planet, the higher the Origin Energy, and the stronger the Civilization. Some people made theirs with Qi to create a Martial Arts Civilization, everyone on the Planet was a Martial Arts practitioner. Some people made theirs with Magic to create a Magical Civilization, everyone on the Planet was a Mage. Some people made their with Spiritual Energy to create an Immortal Civilization, everyone on the Planet was an Immortal Cultivator. Everyone was trying their best to construct all sorts of extraordinary planets. Sebastian, on the other hand, used his memories from his previous life to create a technological civilization! "Your Star Destroyer directly pierced through the opponent's planet, and the opponent bowed their head." "Your two-way foil turned the opponent's planet into a piece of paper, and you frightened them." This story uses technology to break through all sorts of Supernatural Civilizations. Sorry, my English is average, so forgive me if there is a mistake. The later chapter will have better quality, The cover art is from: Cole_Thomas_The_Course_of_Empire_The_Arcadian_or_Pastoral_State_1836
Teenaged God by TheHermitCrab_01
9 parts Ongoing Mature
In a world where humans fight dragons and monsters with mystical forces called magic, a genius 17-year-old is summoned by an unknown force. With his knowledge and understanding of Earth being able to help him grow, he becomes a godly being with unlimited potential. Will he fight demons and dragons to reign supreme, become a hero, or be the villain, rule the world, and be all-powerful? Watch as this lonely kid tears himself apart finding his morals and keeping himself steady. You know what they say, power can corrupt anyone. So let's see what happens when the child gets the gun. WARNING: CONTENT MAY NOT BE SUITABLE FOR ALL VIEWERS!! UPDATES WILL BE LONG, SLOW, AND INCONSISTENT!
You may also like
Slide 1 of 10
The Greatest Warlord cover
Terra Preta cover
Forgotten cover
G.H.O.S.T.: The Vaknar War cover
The Final Countdown - Season I cover
Expanded Horizons: Beyond the Blue cover
Elven Legacy (Part 2) cover
Legend of The Godkids [Published] cover
Build A Scientific And Technological Civilization cover
Teenaged God cover

The Greatest Warlord

18 parts Ongoing

Two thousand years have passed since The Evil King's reign. A young man awakens from his long, deep slumber of perpetual nightmares. He was once The Evil King's Greatest Warlord. Confused, he has lost all memory of his past life, including The Evil King's identity and the reason why he served him. The only thing he remembers is his time spent with his colleagues as The Evil King's Warlord. The wound from his defeat by The Heroes makes him unable to forgive himself, leading him to give in to the hatred he long harboured. This created the perpetual nightmare he has suffered through for 2,000 years. Anger, sadness, and hatred have fused into one, living on inside the man he once was. He accepts his second chance at life when he awakens in front of a lady who was once his colleague. Together, they live peacefully and search for the meaning of the new life granted to him by The Evil King. Until then, the stars falling from the sky, bringing daylight to the night and enlivening the city. Once again, The Young Man sees the greed in human nature. Leading him to another chaos and destruction in the name of justice.

More details