Alice's adventures in Wonderland; by Lewis Carroll
medusartt
  • Reads 205
  • Votes 4
  • Parts 12
  • Time 2h 6m
  • Reads 205
  • Votes 4
  • Parts 12
  • Time 2h 6m
medusartt
Complete, First published Mar 26, 2020
aliceinwonderlandaliciaaliciaenelpaísdelasmaravillasclassicdisneyfilmlewislocuramoviessombrererosombrereroloco
Original book by Lewis Carroll
Respective rights.
Public Domain
aliceinwonderlandaliciaaliciaenelpaísdelasmaravillasclassicdisneyfilmlewislocuramoviessombrererosombrereroloco
Table of contents

12 parts

Sign up to add Alice's adventures in Wonderland; by Lewis Carroll to your library and receive updates
or
#955locura
Content Guidelines
You may also like
[the lion the witch and the Wardrobe] Edmund x reader {completed} by Honk_Chocolate
12 parts Complete
[started]: sept 22 2019 [Completed]: Oct 14 2019
The Light of Narnia - Book 1 (Narnia X OCish Reader) by okamusame
35 parts Complete
Book 1 of 3 - based mostly on the movie though I have indeed read all the books too which means there might be slight influences. Or maybe my own little twists. Narnia in general does not belong to me but original scenes and ideas obviously do. I also don't own the cover art, if you're the owner and wish me to change it, please reach out. Cover made with Canva.
My Precious Flower by thelittleblackghost
16 parts Complete
Male Isabela Madrigal x Female Reader Based on the Disney movie Encanto. (Y/n) = Your Name (H/l) = Hair Length (H/c) = Hair Color (E/c) = Eye Color (S/c) = Skin Color I OWN NOTHING!!! ALL RIGHTS GO TO DISNEY!!!
Beauty || Descendants ✔️ by a_lynwrites
32 parts Complete
"Beauty is found within, not on the surface" Fem Oc X Male Oc ¡Disclaimer! I do not own Descendants, that includes the movies, books and the over all franchises and characters. I own my own characters Briar, Chris, and their storyline. All rights go to the owners.
Luisa Madrigal x Fem!Reader Oneshots by Nighttra
28 parts Complete Mature
I do not own Encanto or any of the characters! They belong to Disney! I don't own any of the art in this book either!
A New Beginning | Edmund Pevensie {1} by Gr4c3K4y
25 parts Complete
When the Pevensies return to Finchley they don't know how they'll cope without Narnia . That is until they bump into Arabella Greene a girl with a bright and daring personality, who loves listening to their stories of a magical land filled with talking animals and lively plants. Little does she know they are not just stories. How will she cope being brought to the new land to fight a war, whilst trying to grasp her feelings for the second youngest Pevensie? -- Edmund Pevensie x oc -- Prince Caspian timeline -- *Note: I do not own any of the Narnia franchise all rights go to C.S Lewis, Disney and the Narnia movies. I only own my OC, Arabella.
Raise a Glass to Freedom by JohnLaurens_tho
18 parts Complete
Lams College AU it's basically just a basic college AU with a bit more angst, I apologise if it's shit. Plz don't copy this book None of the Characters are mine, they're based of real people and Lin - Manuel Miranda/ Hamilton's OBC representation on them.
the games ↠ cato hadley by cxrbitch
11 parts Complete Mature
book 1 of the mockingjay trilogy↠ "𝘭𝘰𝘷𝘦 𝘥𝘰𝘦𝘴𝘯'𝘵 𝘴𝘦𝘯𝘥 𝘺𝘰𝘶 𝘩𝘰𝘮𝘦" cato hadley x oc i only own the oc's and any plot changes in this story. all rights to suzanne collins.
A Soldier's Chorus~Laurens X Reader[COMPLETED✔️] by _multifantasy_
20 parts Complete
*THIS BOOK HAS A SEQUEL* ❤️❤️❤️
The Pevensies by LoveTheNerd
56 parts Complete
Elizabeth Pevensie finds herself swept into the enchanted world of Narnia alongside her siblings. Uncertain and awed by the world's wonders, Elizabeth and her siblings soon discover they are part of an ancient prophecy, destined to protect Narnia from darkness. As they navigate the trials of a world filled with mythical creatures, hidden dangers, and powerful allies, the Pevensies must stand together to fulfill their destiny. Will they rise to the challenge and save Narnia, or will the weight of the prophecy prove too great? All rights to Disney, C.S. Lewis and Narnia. I only own my character(s). ~COPYRIGHTED ©️ January 10th 2020~ (COMPLETED) Story can also be found on my Quotev and AO3. Cover by: AlexMorgan3213
You may also like
Slide 1 of 10
[the lion the witch and the Wardrobe] Edmund x reader {completed} cover
The Light of Narnia - Book 1 (Narnia X OCish Reader) cover
My Precious Flower cover
Beauty || Descendants ✔️ cover
Luisa Madrigal x Fem!Reader Oneshots cover
A New Beginning | Edmund Pevensie {1} cover
Raise a Glass to Freedom cover
the games ↠ cato hadley cover
A Soldier's Chorus~Laurens X Reader[COMPLETED✔️] cover
The Pevensies cover

[the lion the witch and the Wardrobe] Edmund x reader {completed}

12 parts Complete

[started]: sept 22 2019 [Completed]: Oct 14 2019

More details