Death Game
youcantseeher
  • Reads 1,933
  • Votes 149
  • Parts 29
  • Reads 1,933
  • Votes 149
  • Parts 29
youcantseeher
Complete, First published Apr 23, 2020
Mature
angerbloodstreamscardscomedydeathgameenvyfearfriendshipgamegluttonyhatelifelovelustsmystery-thrillerpassionpridesecretssinssurvivalteensthrillertragicpasttruthunfoldwrath
Sa dami ng kasamaan sa mundo, ano nga ba ang pinaka mabigat?

A group of friends decides to travel to an infamous haunted house with a rumoured tragic past, which they thought could be a fun place to hang out to. But what they didn't know is there'll be a mysterious sequence of events waiting for them to happen. Events suddenly start to unfold as their group picked off one by one by a mysterious killer. Now the remaining members of the gang must find a way to solve the mystery of their missing friends before its too late. One must happen to see, or everyone else dies.

Isa-isang lalabas ang katotohanan, unti unting makikilala ang bawat isa. 

This story tells us about 8 different people, 8 different personalities, and 8 different secrets but only one night to reveal of all them. 


It's a matter of winning a game that requires the truth behind every lie.



Sinong mananalo?







Ikaw, sali ka?





DEATH GAME...




Date Started: May 2020
© All Rights Reserved
All Rights Reserved
angerbloodstreamscardscomedydeathgameenvyfearfriendshipgamegluttonyhatelifelovelustsmystery-thrillerpassionpridesecretssinssurvivalteensthrillertragicpasttruthunfoldwrath
Table of contents

29 parts

Sign up to add Death Game to your library and receive updates
or
Content Guidelines
You may also like
I Love You since 1892 (Published by ABS-CBN Books) by UndeniablyGorgeous
56 parts Complete
Si Carmelita Montecarlos ay ang bunsong anak ng pinakamayamang angkan sa San Alfonso. Habang si Juanito Alfonso naman ay ang anak ng pinakamaimpluwensiya at makapangyarihang gobernadorcillo. Itinadhana silang mag-ibigan na pinagtibay ng kasunduan. Nakatakda silang ikasal sa ika-dalawampung kaarawan ni Carmelita. Ngunit sa mismong araw ng kanilang engrandeng kasal ay binaril si Juanito. At hindi na nalaman pa kung sino ang may sala nito. Inakala ng lahat na doon na nagtapos ang kanilang masaklap na kuwento. Na gaya ng kanilang mga kaluluwa ay sumasalangit na rin ang naudlot na pag-iibigan nilang dalawa. Ang hindi nila alam, may ibang plano ang tadhana. The laws of nature will bend. After more than 104 years, Carmela, the fourth generation of the Montecarlos clan will be born on a leap year - sa parehong araw ng kapanganakan ni Carmelita. A short trip to San Alfonso for her 20th birthday will give her rebellious life a whimsical twist. Through a diary, she'll go back in time. And the Carmela of 2016 will meet Juanito of 1892. Next story to read after ILYS1892: 1. Our Asymptotic Love Story 2. Bride of Alfonso Book Cover by: ABS-CBN Publishing Started: June 01, 2016 Completed: April 27, 2017
"Defend Me, Attorney." (Law Series #1) by Veilofthedark
22 parts Complete
[PUBLISHED under LIB] #1. "If pleading guilty means protecting you, I will."
How To Make A Serial Killer by Serialsleeper
44 parts Complete
Crime and murder podcaster Wren Lozarte is desperate to earn money for her ailing uncle so she accepts a strange but high-paying offer from a mysterious businessman. What started as an unusual marketing scheme becomes a fight for survival when the "serial killer" they created seemingly came to life. *** After returning to her hometown to take care of her uncle who has cancer, Elianna Wren Lozarte realized that the money she earns from podcasting true crime stories isn't enough to support them. So, when a staff from Tramwell Industries offers her a high paying job-become part of a marketing scheme to stir up fear in people into believing that there's a serial killer to make them buy the company's upcoming state of the art security system-Wren accepts. Making a serial killer? That's an easy one. The hard part is when the killings become real, and entangled secrets reveal themselves before her very eyes. Disclaimer: This story is written in Taglish. Cover Design by: Rayne Mariano
RUN AS FAST AS YOU CAN (Completed) by ShinichiLaaaabs
54 parts Complete
[RFYL book 2] When the enemy is close behind, you need to run as fast as you can. RUN AS FAST AS YOU CAN Written by: SHINICHILAAAABS Genre: Science Fiction August 2, 2018
The Billionaire's Obsession by JFstories
52 parts Complete Mature
What H wants, H gets. And Camilla is not an exception. Montemayor Saga [ complete ] [ old story reposted ]
Ang Mutya Ng Section E by eatmore2behappy
130 parts Ongoing Mature
Masarap mapunta sa Section na may pagkaka-isa. Meron mang hnd pagkaka-unawaan, napag-uusapan naman. Panu kung mapunta ka sa Section na ikaw lang ang naiiba. Kakayanin mo ba?
Hell University (PUBLISHED) by KnightInBlack
67 parts Complete
A place where everything is mysterious, enchanting, bloody, and shitty. Entering is the other way of suicidal. Just one wrong move and everything will blur. A lot of secrets are being hid. Not the typical school to have fun. Death is everywhere. Bad, worse, worst, monster and evil are scattered. Must shut your mouth, never against to anyone. "Once you enter, there's no turning back." Never trust your curiosity, it could just drive you straight to hell. WELCOME TO HELL UNIVERSITY! --**-- Date Started: February 8, 2016 Date Finished: August 17, 2016. Mystery/Thriller/Teen-Fiction Book Cover by PixyGoddess
RUN FOR YOUR LIFE by ShinichiLaaaabs
72 parts Complete
In the near dystopian future where the population has blown up, women and the poor are more oppressed, and those with positions who abuse their power remain unscathed, a girl called Sunny wants nothing more than to break the vicious system. But how can she do this if all they can do is run for their lives? *** In the year 2070, impulsive, tactless, and hardheaded Sonia "Sunny" Gallego enters the First Ward Academy with a goal in mind: get an important position at the Capital and break the rotten system. She abhors that women and the poor are oppressed yet again, and those in positions of power are still abusing their authorities, only now coupled with advanced technology. With royal face-offs, ultimate meat researches, past secrets, and family revelations coming her way, she learns that what she has in mind is not an easy task. Will she be able to break the system or will she be a part of it? "Life is a race," they say, "so run for your life!" DISCLAIMER: This story is written in Taglish COVER DESIGN: Rayne Mariano"
Project: Yngrid by Alesana_Marie
23 parts Complete
What would you do if you wake up one day and find yourself in a different body? [Completed]
You may also like
Slide 1 of 9
I Love You since 1892 (Published by ABS-CBN Books) cover
"Defend Me, Attorney." (Law Series #1) cover
How To Make A Serial Killer cover
RUN AS FAST AS YOU CAN (Completed) cover
The Billionaire's Obsession cover
Ang Mutya Ng Section E cover
Hell University (PUBLISHED) cover
RUN FOR YOUR LIFE cover
Project: Yngrid cover

I Love You since 1892 (Published by ABS-CBN Books)

56 parts Complete

Si Carmelita Montecarlos ay ang bunsong anak ng pinakamayamang angkan sa San Alfonso. Habang si Juanito Alfonso naman ay ang anak ng pinakamaimpluwensiya at makapangyarihang gobernadorcillo. Itinadhana silang mag-ibigan na pinagtibay ng kasunduan. Nakatakda silang ikasal sa ika-dalawampung kaarawan ni Carmelita. Ngunit sa mismong araw ng kanilang engrandeng kasal ay binaril si Juanito. At hindi na nalaman pa kung sino ang may sala nito. Inakala ng lahat na doon na nagtapos ang kanilang masaklap na kuwento. Na gaya ng kanilang mga kaluluwa ay sumasalangit na rin ang naudlot na pag-iibigan nilang dalawa. Ang hindi nila alam, may ibang plano ang tadhana. The laws of nature will bend. After more than 104 years, Carmela, the fourth generation of the Montecarlos clan will be born on a leap year - sa parehong araw ng kapanganakan ni Carmelita. A short trip to San Alfonso for her 20th birthday will give her rebellious life a whimsical twist. Through a diary, she'll go back in time. And the Carmela of 2016 will meet Juanito of 1892. Next story to read after ILYS1892: 1. Our Asymptotic Love Story 2. Bride of Alfonso Book Cover by: ABS-CBN Publishing Started: June 01, 2016 Completed: April 27, 2017

More details