Story cover for Death Game by youcantseeher
Death Game
youcantseeher
  • WpView
    Reads 2,342
  • WpVote
    Votes 162
  • WpPart
    Parts 29
  • WpView
    Reads 2,342
  • WpVote
    Votes 162
  • WpPart
    Parts 29
youcantseeher
Complete, First published Apr 23, 2020
Mature
angerbloodstreamscardscomedydeathgameenvyfearfriendshipgamegluttonyhatelifelovelustsmystery-thrillerpassionpridesecretssinssurvivalteensthrillertragicpasttruthunfoldwrath
Sa dami ng kasamaan sa mundo, ano nga ba ang pinaka mabigat?

A group of friends decides to travel to an infamous haunted house with a rumoured tragic past, which they thought could be a fun place to hang out to. But what they didn't know is there'll be a mysterious sequence of events waiting for them to happen. Events suddenly start to unfold as their group picked off one by one by a mysterious killer. Now the remaining members of the gang must find a way to solve the mystery of their missing friends before its too late. One must happen to see, or everyone else dies.

Isa-isang lalabas ang katotohanan, unti unting makikilala ang bawat isa. 

This story tells us about 8 different people, 8 different personalities, and 8 different secrets but only one night to reveal of all them. 


It's a matter of winning a game that requires the truth behind every lie.



Sinong mananalo?







Ikaw, sali ka?





DEATH GAME...




Date Started: May 2020
© All Rights Reserved
All Rights Reserved
angerbloodstreamscardscomedydeathgameenvyfearfriendshipgamegluttonyhatelifelovelustsmystery-thrillerpassionpridesecretssinssurvivalteensthrillertragicpasttruthunfoldwrath
Table of contents

29 parts

Sign up to add Death Game to your library and receive updates
or
Content Guidelines
You may also like
Hide n Kill by StarnightEclipse
28 parts Complete Mature
Authors' Note This is a story about survival and strategy, about friendship and loyalty, about betrayal and sacrifice. The writing of this story has been a difficult task. We, the authors of this story, had to overcome numerous challenges before we were able to complete it and meet our expectations. This story is fiction and it was created from our vast imagination to provide readers with thrilling thrills and excitement. Scenarios in this story may be similar to those in other stories, but this is not done on purpose. We can't promise to give you all a perfect story because we aren't that experienced in making them and are still growing and learning along the way, but it will be worthwhile as long as we know we've given it our all. Thank you for all of the support and assistance that will be provided to us. We may not name you, but you are all deeply appreciated and remembered in our hearts. Thank you once more, and God bless you! Disclaimer: All names, places, characters, plot twists, and events are purely fictitious creations of the authors. If there is a resemblance, it is purely coincidental and not intended to be adopted. Copyright© All right reserved. No part of this book may be produced, distributed, or transmitted in any form or by any means, including printing, recording or other electronic or mechanical methods, without the prior written permission of the authors, except in the case of brief quotations embodied in critical reviews and certain other noncommercial uses permitted by copyright law. ALL RIGHTS RESERVED
Haunter Files (Flash Fiction Horror Stories) by UHSHaunters
24 parts Complete Mature
May mga bagay na hindi nakikita, nararamdaman, at nalalaman ng iba. Ang mundo ay sadyang kakaiba at 'di kapani-paniwala. Ito'y puno ng lihim na nagkukubli sa dilim at bumubulag sa katotohanang hindi batid ng karamihan. Kaya mo bang tuklasin ang lihim ng mundo? Kakayanin mo ba ang kilabot na babalot sa iyo? Mag-ingat sa daang iyong tatahakin. Hindi biro ang mundong iyong papasukin. Narito ang Haunter Files Flash Fiction Stories na dadalhin ka sa mundo ng kababalaghan. Naglalaman ng mga kuwento na magdudulot ng kilabot sa iyong katawan. Ito ang mga kuwentong magpapatunay na may mga bagay sa mundo na hindi mo dapat makita, pero kailangan mong matuklasan. Ikandado ang pinto. Isarado ang bintana. Patayin ang ilaw. Humiga sa kama. At simulang magbasa habang ika'y nag-iisa!
THE TERRIBLE NIGHT IS OVER (DON'T LET IT BE YOUR NIGHTMARE) by MrInkheart
32 parts Complete Mature
Likas na sa mga kabataan ang mag explore at alamin, ang iba't ibang bagay, kahit pa mapanganib ito. Paano kung isang araw ang kagustuhan niyong tuklasin ang ibang bagay, at sumubok ng ilang mga gawain, ay mauwi sa hindi inaasahang gabi?! Lingid sa kaalaman ng grupo ng magkakaibigan na, ang masaya sana nilang gala ay mauuwi sa isang malagim na gabi. Paano nila tatakasan ang isang lugar na nag lalaman ng misteryo at kababalaghan? Paano kung isang araw matuklasan mo nalang, ang isa sa iyong mga kaiibigan. Ay Hindi TOTOO?at kayang PUMATAY? ng Isa pang KAIIBIGAN? "Ano ang gagawin mo!?" ''DON'T LET IT BE YOUR NIGHTMARE'' Book Cover by: Nathaniel Date started: January 17, 2022 Date finished: December 3, 2022 Major Editing finished: November 11, 2024
When all else falls [COMPLETED] by Dalandaniela
30 parts Complete Mature
R-18 some scenes may not be comfortable for readers below eighteen years of age. Read at your own risk. What's really living? Ano ba talaga ang ibig sabihin ng mabuhay? Sa mundong ginagalawan natin, living can be mistaken for surviving. Lahat ng tao sa mundo ay may kaniya-kaniyang buhay, kaniya-kaniyang pinagdadaanan. Lahat ng tao sa mundo ay sinusubukang mabuhay ngunit hindi parin sapat, because life will always pull you to the lowest of low and all you have to do is to climb back up, surviving, with very little hope for actually living. It isn't always like what we depict in novels, movies, even the songs you lsiten to when you want to be happy. In life, well always struggle to be complete and whole but when all else falls, where do you always find yourself? Cosmic Void #1 #2 in nightmares 08-16-20
Classroom Full of Secrets (COMPLETED) by Ann_Mysterious
60 parts Complete Mature
"SECRET" ...anim na letra pero meron lamang nag-iisang kahulugan. Iyon ay ang pagtago ng lihim na hindi pwedeng malaman ninuman. Sekretong hindi mo aasahang totoo, na sa kabila ng kanilang maaamong mukha at maaliwalas na mga ngiti ay meron palang demonyo na nakakubli. Kaya ihanda ang iyong sarili para sa kuwentong magpapamulat sayo ng kung ano na talaga ang totoong estado ng ating mundo... WARNING: Beware of beautiful faces, some of them are dangerous. | Photo used on the cover is not mine. Credits to the real owner. | Date Finished: April 22, 2020
The Queen Of Two Dimensions by Mirmana
115 parts Complete Mature
"Don't be a helter-skelter of one thing that you didn't know that in the end, you will regret it. Think before you make a move. Don't be selfish, don't be self-centered. Take time to think for you to be contented with the outcome," He once said. "You talk so much shit. I don't know whether to offer you a breath mint or a toilet paper. You know, not everything happens for a reason. Sometimes, life just sucks." She then replied. She's Death Born as a goddess, yet a devil She's innocent but witty and dangerous. She's cold, but she cares. She possesses the greatest powers, but none of them knows She's tough, but he's her weakness. Once she got angry, Oh man! Run for your life. Wanna know her more? Well, then, join her as she unleashes her deepest secret. Secret that will soon be the cause of either destruction or freedom. Plagiarism is a crime. This story is a work of purely action fantasy. Names, characters, businesses, organizations, places, events, and incidents either are the product of the author's imagination. Any resemblance to actual persons, living or dead, events, or locales is entirely coincidental. Language used: Tagalog-English WARNING: R-18 | MATURED CONTENT | READ AT YOUR OWN RISK.
Happy Bloody Celebration (R-18) by BM_BLACK301
34 parts Complete Mature
Dalawang desisyon ang nabuo at sa iisang lugar. Isang trip na bakasyon na pagsisimulan nang lahat, isang masaya na selebrasyon at sa huli 'ay hindi mo na magagawa pang tumawa. Dahil sa kanilang pabigla-bigla na desisyon ang siyang maglalagay sa kanilang lahat sa kamatayan. May makakaligtas kaya sa malagim na gabi? O mamatay silang lahat na walang nakakaalam sa kanilang mga sinapit? Samahan natin sila sa kanilang masayang selebrasyon, ang tumakbo na walang humpay at kabang magpababaliw sa katinuan, kasama na ang takot na mararamdaman ng bawat isa. ------- ------- BABALA MARAMING NAGLALAMAN ITO NA HINDI ANGKOP SA MGA TAONG MAHINA ANG PANGUNAWA AT HINDI SANAY SA MGA GANITONG KUWENTO AT EKSENA. ASAHAN ANG MGA MABABASA RITO AY PARTE NG STORYA NA ITO. HUWAG KAYONG ANO DIYAN! CHARR! ®BM_BLACK301
Psychology Class 101 by estrangheraaaa
26 parts Complete Mature
BE CAREFUL WHO YOU TRUST. Magtitiwala ka pa ba pagkatapos mabasa ang kagimbal-gimbal na trahedya sa fieldtrip ng Psychology class 101? This is a work of fiction. Names, characters, places, events and incident are either the product of the author's imagination or used in a fictitious manners. Any resemblance to an actual person, living or dead or actual events are purely coincidental. Do not distribute, publish, transmit, modify, display or create derivative works from or exploit the content of this story in any way. Please obtain permission. ~Psychology 101~ Genre: horror Warning SPG IF YOU'RE UNDER 18, DON'T READ THIS. THIS MIGHT CONTAIN SCENES NOT SUITABLE FOR YOUR AGE.
Room 013: The 13th floor ✓ by Kyxwinter
37 parts Complete Mature
Completed. Isang sekretong kinakatakutan ng lahat, Sekretong iniingatan. Sekretong magdadala ng kapahamakan, Magtitiwala ka pa kaya, kapag nalaman mong isa sa inyo ang may gawa? In this class, betrayal is just a game. Don't trust anyone. Sarili mo lang dapat ang pagkatiwalaan mo, Dahil ang tiwala mo ang siyang magdadala sayo sa mismong lamay mo. Started date : April 27, 2020 Finished: May 28, 2020
Kasalanan ang Pagdilat: Tales of Horror by richfckingdumas
15 parts Complete Mature
Nandito ka ngayon sa pinaka-madilim na bahagi ng wattpad, kung saan ang pagdilat ay kasalanan at ang pagpikit ay kamatayan. Hayaan mong tangayin ka ng mga istoryang dadalhin ka sa anim na talampakan pailalim, kung saan ang mga nakatikom ay walang takas at wag maniwala sa mga labing nakabukas. Wag palilinlang sa iyong utak, dahil hindi lahat ng iyong nakikita ay totoo, tumingin palagi sa ilalim ng kama, at baka makita mo ang demonyong nakangiti sayo. DISCLAIMER: This is a work of fiction. Names, characters, places and incidents either are products of the author's imagination or are used fictitiously. Any resemblance to actual events or locales or persons, living or dead, is entirely coincidental.
You may also like
Slide 1 of 10
Hide n Kill cover
Haunter Files (Flash Fiction Horror Stories) cover
THE TERRIBLE NIGHT IS OVER (DON'T LET IT BE YOUR NIGHTMARE) cover
When all else falls [COMPLETED] cover
Classroom Full of Secrets (COMPLETED) cover
The Queen Of Two Dimensions cover
Happy Bloody Celebration (R-18) cover
Psychology Class 101 cover
Room 013: The 13th floor ✓ cover
Kasalanan ang Pagdilat: Tales of Horror cover

Hide n Kill

28 parts Complete Mature

Authors' Note This is a story about survival and strategy, about friendship and loyalty, about betrayal and sacrifice. The writing of this story has been a difficult task. We, the authors of this story, had to overcome numerous challenges before we were able to complete it and meet our expectations. This story is fiction and it was created from our vast imagination to provide readers with thrilling thrills and excitement. Scenarios in this story may be similar to those in other stories, but this is not done on purpose. We can't promise to give you all a perfect story because we aren't that experienced in making them and are still growing and learning along the way, but it will be worthwhile as long as we know we've given it our all. Thank you for all of the support and assistance that will be provided to us. We may not name you, but you are all deeply appreciated and remembered in our hearts. Thank you once more, and God bless you! Disclaimer: All names, places, characters, plot twists, and events are purely fictitious creations of the authors. If there is a resemblance, it is purely coincidental and not intended to be adopted. Copyright© All right reserved. No part of this book may be produced, distributed, or transmitted in any form or by any means, including printing, recording or other electronic or mechanical methods, without the prior written permission of the authors, except in the case of brief quotations embodied in critical reviews and certain other noncommercial uses permitted by copyright law. ALL RIGHTS RESERVED

More details