Death Game
youcantseeher
  • Reads 1,941
  • Votes 149
  • Parts 29
  • Reads 1,941
  • Votes 149
  • Parts 29
youcantseeher
Complete, First published Apr 23, 2020
Mature
angerbloodstreamscardscomedydeathgameenvyfearfriendshipgamegluttonyhatelifelovelustsmystery-thrillerpassionpridesecretssinssurvivalteensthrillertragicpasttruthunfoldwrath
Sa dami ng kasamaan sa mundo, ano nga ba ang pinaka mabigat?

A group of friends decides to travel to an infamous haunted house with a rumoured tragic past, which they thought could be a fun place to hang out to. But what they didn't know is there'll be a mysterious sequence of events waiting for them to happen. Events suddenly start to unfold as their group picked off one by one by a mysterious killer. Now the remaining members of the gang must find a way to solve the mystery of their missing friends before its too late. One must happen to see, or everyone else dies.

Isa-isang lalabas ang katotohanan, unti unting makikilala ang bawat isa. 

This story tells us about 8 different people, 8 different personalities, and 8 different secrets but only one night to reveal of all them. 


It's a matter of winning a game that requires the truth behind every lie.



Sinong mananalo?







Ikaw, sali ka?





DEATH GAME...




Date Started: May 2020
© All Rights Reserved
All Rights Reserved
angerbloodstreamscardscomedydeathgameenvyfearfriendshipgamegluttonyhatelifelovelustsmystery-thrillerpassionpridesecretssinssurvivalteensthrillertragicpasttruthunfoldwrath
Table of contents

29 parts

Sign up to add Death Game to your library and receive updates
or
Content Guidelines
You may also like
Psychology Class 101 by estrangheraaaa
26 parts Complete Mature
BE CAREFUL WHO YOU TRUST. Magtitiwala ka pa ba pagkatapos mabasa ang kagimbal-gimbal na trahedya sa fieldtrip ng Psychology class 101? This is a work of fiction. Names, characters, places, events and incident are either the product of the author's imagination or used in a fictitious manners. Any resemblance to an actual person, living or dead or actual events are purely coincidental. Do not distribute, publish, transmit, modify, display or create derivative works from or exploit the content of this story in any way. Please obtain permission. ~Psychology 101~ Genre: horror Warning SPG IF YOU'RE UNDER 18, DON'T READ THIS. THIS MIGHT CONTAIN SCENES NOT SUITABLE FOR YOUR AGE.
Room 013: The 13th floor |✓ [UNDER EDITING] by Kyxwinter
37 parts Complete Mature
Completed. Isang sekretong kinakatakutan ng lahat, Sekretong iniingatan. Sekretong magdadala ng kapahamakan, Magtitiwala ka pa kaya, kapag nalaman mong isa sa inyo ang may gawa? In this class, betrayal is just a game. Don't trust anyone. Sarili mo lang dapat ang pagkatiwalaan mo, Dahil ang tiwala mo ang siyang magdadala sayo sa mismong lamay mo. Started date : April 27, 2020 Finished: May 28, 2020
The Queen Of Two Dimensions by Mirmana
115 parts Complete Mature
"Don't be a helter-skelter of one thing that you didn't know that in the end, you will regret it. Think before you make a move. Don't be selfish, don't be self-centered. Take time to think for you to be contented with the outcome," He once said. "You talk so much shit. I don't know whether to offer you a breath mint or a toilet paper. You know, not everything happens for a reason. Sometimes, life just sucks." She then replied. She's Death Born as a goddess, yet a devil She's innocent but witty and dangerous. She's cold, but she cares. She possesses the greatest powers, but none of them knows She's tough, but he's her weakness. Once she got angry, Oh man! Run for your life. Wanna know her more? Well, then, join her as she unleashes her deepest secret. Secret that will soon be the cause of either destruction or freedom. Plagiarism is a crime. This story is a work of purely action fantasy. Names, characters, businesses, organizations, places, events, and incidents either are the product of the author's imagination. Any resemblance to actual persons, living or dead, events, or locales is entirely coincidental. Language used: Tagalog-English WARNING: R-18 | MATURED CONTENT | READ AT YOUR OWN RISK.
The Dangerous Princess: The Red-Eyed Lady by shannybelleza
57 parts Complete
COMPLETED | SELF-PUBLISHED "And you're from?" "Earth, of course!" natatawa kong sagot. Natawa lamang siya sa sagot ako. "Specific, iha. Sa Witchery World ka ba galing?" And that caught my attention. I stared at her blankly before blinking a few times. "What?" As if she caught my reaction, she asked, "Are you from Mortal World?" What? Of course, we all are. She's talking like there's other world existing today! "Yes, and so as you," I said and pointed a finger on her. She eyed me curiously. "No." Her answer came out instantly. No doubts and lies. I am starting to panic and my heart beats three times faster than normal. "We're on Magic World, iha. And you're talking to an old woman with pouvoir," she said. ------- "If darkness is my friend, then light is my bestfriend." Fiona Renee Evergreen, your dangerous princess with her dangerous red eyes. Date started: January 19, 2018 Date finished: March 18, 2018
The Secret Coven: The Mysterious Nerds by ItsOtakuAiran
46 parts Complete
ITS ALL ABOUT THEM, THEIR IDENTITY, THEIR SKILLS, THEIR HISTORY AND THEIR WORLD. IT IS ALL ABOUT THEIR MOST HIDDEN SECRETS THAT CANNOT BE KEEP IN TOUCH AND FIND OUT BY OTHERS. Most Tagalog and English Language. All Genre. But most Mystery and Thrill. Vote. Comment. Share. Follow. Are not highly recommended but I would love to if you do, accepted and appreciated. Arigatou gosaimasu minna-san. Tulungan niyo po sana ako mapalaganap ang istoryang ito. 😊❤😇 YOUR MAGNIFICENT MALEFICENT
Kasalanan ang Pagdilat: Tales of Horror by richfckingdumas
15 parts Complete Mature
Nandito ka ngayon sa pinaka-madilim na bahagi ng wattpad, kung saan ang pagdilat ay kasalanan at ang pagpikit ay kamatayan. Hayaan mong tangayin ka ng mga istoryang dadalhin ka sa anim na talampakan pailalim, kung saan ang mga nakatikom ay walang takas at wag maniwala sa mga labing nakabukas. Wag palilinlang sa iyong utak, dahil hindi lahat ng iyong nakikita ay totoo, tumingin palagi sa ilalim ng kama, at baka makita mo ang demonyong nakangiti sayo. DISCLAIMER: This is a work of fiction. Names, characters, places and incidents either are products of the author's imagination or are used fictitiously. Any resemblance to actual events or locales or persons, living or dead, is entirely coincidental.
Classroom Full of Secrets (COMPLETED) by Ann_Mysterious
60 parts Complete Mature
"SECRET" ...anim na letra pero meron lamang nag-iisang kahulugan. Iyon ay ang pagtago ng lihim na hindi pwedeng malaman ninuman. Sekretong hindi mo aasahang totoo, na sa kabila ng kanilang maaamong mukha at maaliwalas na mga ngiti ay meron palang demonyo na nakakubli. Kaya ihanda ang iyong sarili para sa kuwentong magpapamulat sayo ng kung ano na talaga ang totoong estado ng ating mundo... WARNING: Beware of beautiful faces, some of them are dangerous. | Photo used on the cover is not mine. Credits to the real owner. | Date Finished: April 22, 2020
Haunter Files (Flash Fiction Horror Stories) by UHSHaunters
24 parts Complete Mature
May mga bagay na hindi nakikita, nararamdaman, at nalalaman ng iba. Ang mundo ay sadyang kakaiba at 'di kapani-paniwala. Ito'y puno ng lihim na nagkukubli sa dilim at bumubulag sa katotohanang hindi batid ng karamihan. Kaya mo bang tuklasin ang lihim ng mundo? Kakayanin mo ba ang kilabot na babalot sa iyo? Mag-ingat sa daang iyong tatahakin. Hindi biro ang mundong iyong papasukin. Narito ang Haunter Files Flash Fiction Stories na dadalhin ka sa mundo ng kababalaghan. Naglalaman ng mga kuwento na magdudulot ng kilabot sa iyong katawan. Ito ang mga kuwentong magpapatunay na may mga bagay sa mundo na hindi mo dapat makita, pero kailangan mong matuklasan. Ikandado ang pinto. Isarado ang bintana. Patayin ang ilaw. Humiga sa kama. At simulang magbasa habang ika'y nag-iisa!
The Mafia Heir Book 1 (Published Under PSICOM) by DarkEvilWitch
44 parts Complete Mature
✔︎𝑷𝒖𝒃𝒍𝒊𝒔𝒉𝒆𝒅 𝒖𝒏𝒅𝒆𝒓 𝑷𝑺𝑰𝑪𝑶𝑴 𝐴𝑢𝑡ℎ𝑜𝑟'𝑠 𝑁𝑜𝑡𝑒: 𝑇ℎ𝑖𝑠 𝑏𝑜𝑜𝑘 𝑖𝑠 𝑡ℎ𝑒 𝑅𝐴𝑊 𝑣𝑒𝑟𝑠𝑖𝑜𝑛. 𝐴 𝑙𝑜𝑡 𝑜𝑓 𝑒𝑟𝑟𝑜𝑟𝑠 𝑐𝑎𝑛 𝑏𝑒 𝑓𝑜𝑢𝑛𝑑 𝑖𝑛 𝑡ℎ𝑒 𝑡𝑒𝑥𝑡. 𝑌𝑜𝑢 ℎ𝑎𝑣𝑒 𝑏𝑒𝑒𝑛 𝑤𝑎𝑟𝑛𝑒𝑑. 𝐴𝑣𝑎𝑖𝑙𝑎𝑏𝑙𝑒 𝑛𝑎 𝑟𝑖𝑛 𝑝𝑜 𝑎𝑛𝑔 𝑏𝑜𝑜𝑘 𝑣𝑒𝑟𝑠𝑖𝑜𝑛! 𝐶ℎ𝑒𝑐𝑘 𝑖𝑡 𝑜𝑢𝑡 𝑠𝑎 𝑃𝑆𝐼𝐶𝑂𝑀 𝐹𝐵 𝑝𝑎𝑔𝑒. :)) 𝑻𝒉𝒆 𝑴𝒂𝒇𝒊𝒂 𝑯𝒆𝒊𝒓 𝑩𝒐𝒐𝒌 𝑶𝒏𝒆 : 𝑹𝒆𝒗𝒆𝒏𝒈𝒆 𝒐𝒇 𝒕𝒉𝒆 𝑷𝒂𝒔𝒕 #𝑾𝒂𝒕𝒕𝒚𝒔𝑾𝒊𝒏𝒏𝒆𝒓2015 #𝑪𝒐𝒍𝒍𝒆𝒄𝒕𝒐𝒓𝒔𝑫𝒓𝒆𝒂𝒎 𝑴𝒂𝒇𝒊𝒂. 𝐴 𝑤𝑜𝑟𝑙𝑑 𝑤ℎ𝑒𝑟𝑒 𝑡ℎ𝑒 𝑤𝑜𝑟𝑑 𝑚𝑒𝑟𝑐𝑦 𝑑𝑜𝑒𝑠 𝑛𝑜𝑡 𝑒𝑥𝑖𝑠𝑡. 𝐷𝑒𝑎𝑡ℎ 𝑖𝑠 𝑡ℎ𝑒 𝑜𝑛𝑙𝑦 𝑤𝑎𝑦 𝑡𝑜 𝑒𝑠𝑐𝑎𝑝𝑒 𝑡ℎ𝑒 𝑐𝑟𝑢𝑒𝑙𝑡𝑦... 𝑎𝑟𝑒 𝑦𝑜𝑢 𝑟𝑒𝑎𝑑𝑦 𝑡𝑜 𝑓𝑎𝑐𝑒 𝑦𝑜𝑢𝑟 𝑑𝑒𝑠𝑡𝑖𝑛𝑦? 𝑬𝒗𝒆, 𝑎 𝑛𝑜𝑟𝑚𝑎𝑙 𝑠𝑒𝑣𝑒𝑛𝑡𝑒𝑒𝑛 𝑦𝑒𝑎𝑟 𝑜𝑙𝑑 𝑔𝑖𝑟𝑙 𝑏𝑢𝑡 𝑡ℎ𝑒 𝑠𝑢𝑑𝑑𝑒𝑛 𝑑𝑒𝑎𝑡ℎ 𝑜𝑓 ℎ𝑒𝑓 𝑔𝑟𝑎𝑛𝑑𝑓𝑎𝑡ℎ𝑒𝑟- 𝑤ℎ𝑜 𝑖𝑠 𝑎 𝑚𝑎𝑓𝑖𝑎 𝑏𝑜𝑠𝑠 𝑐ℎ𝑎𝑛𝑔𝑒𝑠 𝑒𝑣𝑒𝑟𝑦𝑡ℎ𝑖𝑛𝑔 𝑖𝑛 𝑎 𝑠𝑛𝑎𝑝. 𝑆ℎ𝑒'𝑠 𝑔𝑜𝑖𝑛𝑔 𝑡𝑜 𝑟𝑒𝑝𝑙𝑎𝑐𝑒 ℎ𝑖𝑠 𝑡ℎ𝑟𝑜𝑛𝑒, 𝑏𝑢𝑡 𝑖𝑠 𝑠ℎ𝑒
MAGIKĒ ACADEMY: THE DEMIGOD by dreamhope_s
36 parts Complete
Zanaira lived a life of quiet monotony - a girl from an unremarkable family, wrapped in the dull threads of an ordinary existence. That is, until the day everything changed. When the people she believed to be her biological parents suddenly arrive, not with comfort but with cryptic warnings and a desperate need to protect her, Zanaira's world begins to unravel. Her life, once grounded in simplicity, is swept away in a whirlwind of revelations. Now, a new identity awaits her in a parallel realm - one pulsing with ancient magic, long-buried secrets, and destinies written in the stars. At Magikē Academy, Zanaira finds herself surrounded by unfamiliar faces, new allies, and whispered legends of demigods. But with each answer comes a thousand new questions. Can she trust this strange new world? Who speaks truth, and who hides behind lies? What dangers lie ahead - and what power lies dormant within her? Zanaira must navigate a maze of uncertainty and deception to uncover the truth about who she really is. And it all begins at Magikē Academy.
You may also like
Slide 1 of 10
Psychology Class 101 cover
Room 013: The 13th floor |✓ [UNDER EDITING] cover
The Queen Of Two Dimensions cover
The Dangerous Princess: The Red-Eyed Lady cover
The Secret Coven: The Mysterious Nerds cover
Kasalanan ang Pagdilat: Tales of Horror cover
Classroom Full of Secrets (COMPLETED) cover
Haunter Files (Flash Fiction Horror Stories) cover
The Mafia Heir Book 1 (Published Under PSICOM) cover
MAGIKĒ ACADEMY: THE DEMIGOD cover

Psychology Class 101

26 parts Complete Mature

BE CAREFUL WHO YOU TRUST. Magtitiwala ka pa ba pagkatapos mabasa ang kagimbal-gimbal na trahedya sa fieldtrip ng Psychology class 101? This is a work of fiction. Names, characters, places, events and incident are either the product of the author's imagination or used in a fictitious manners. Any resemblance to an actual person, living or dead or actual events are purely coincidental. Do not distribute, publish, transmit, modify, display or create derivative works from or exploit the content of this story in any way. Please obtain permission. ~Psychology 101~ Genre: horror Warning SPG IF YOU'RE UNDER 18, DON'T READ THIS. THIS MIGHT CONTAIN SCENES NOT SUITABLE FOR YOUR AGE.

More details