Story cover for Simple Wish by DeaniellCordero
Simple Wish
DeaniellCordero
  • WpView
    Reads 20
  • WpVote
    Votes 0
  • WpPart
    Parts 1
  • WpHistory
    Time 4h 27m
  • WpView
    Reads 20
  • WpVote
    Votes 0
  • WpPart
    Parts 1
  • WpHistory
    Time 4h 27m
DeaniellCordero
Ongoing, First published Aug 28, 2014
adventuretimeattackontitandeathnotedisneyfairytailfairytalefirstbookmarianastrenchpewdiepieteenfiction
Public Domain
adventuretimeattackontitandeathnotedisneyfairytailfairytalefirstbookmarianastrenchpewdiepieteenfiction
Table of contents

1 part

Sign up to add Simple Wish to your library and receive updates
or
#714deathnote
Content Guidelines
You may also like
Saving Elliot ✓ by northbynorth
32 parts Complete
Elliot Jensen and Elliot Fintry have a lot in common. They share the same name, the same house, the same school, oh and they hate each other but, as they will quickly learn, there is a fine line between love and hate.
You may also like
Slide 1 of 1
Saving Elliot ✓ cover

Saving Elliot ✓

32 parts Complete

Elliot Jensen and Elliot Fintry have a lot in common. They share the same name, the same house, the same school, oh and they hate each other but, as they will quickly learn, there is a fine line between love and hate.

More details